Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human TRIM63 Monoclonal Antibody | anti-TRIM63 antibody

TRIM63 (E3 Ubiquitin-protein Ligase TRIM63, Iris RING Finger Protein, Muscle-specific RING Finger Protein 1, MuRF-1, MuRF1, RING Finger Protein 28, Striated Muscle RING Zinc Finger Protein, Tripartite Motif-containing Protein 63, IRF, MURF1, RNF28, SMRZ)

Gene Names
TRIM63; IRF; SMRZ; MURF1; MURF2; RNF28
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIM63; Monoclonal Antibody; TRIM63 (E3 Ubiquitin-protein Ligase TRIM63; Iris RING Finger Protein; Muscle-specific RING Finger Protein 1; MuRF-1; MuRF1; RING Finger Protein 28; Striated Muscle RING Zinc Finger Protein; Tripartite Motif-containing Protein 63; IRF; MURF1; RNF28; SMRZ); anti-TRIM63 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6G6
Specificity
Recognizes human TRIM63.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-TRIM63 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa254-353 from human TRIM63 (NP_115977) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQGFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGH
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of TRIM63 expression in transfected 293T cell line by TRIM63 monoclonal antibody. Lane 1: TRIM63 transfected lysate (40.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TRIM63 expression in transfected 293T cell line by TRIM63 monoclonal antibody. Lane 1: TRIM63 transfected lysate (40.2kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TRIM63 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TRIM63 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged TRIM63 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TRIM63 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of TRIM63 over-expressed 293 cell line, cotransfected with TRIM63 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIM63 monoclonal antibody (M01). GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of TRIM63 over-expressed 293 cell line, cotransfected with TRIM63 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TRIM63 monoclonal antibody (M01). GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-TRIM63 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,950 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM63
NCBI Official Synonym Full Names
tripartite motif containing 63, E3 ubiquitin protein ligase
NCBI Official Symbol
TRIM63
NCBI Official Synonym Symbols
IRF; SMRZ; MURF1; MURF2; RNF28
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM63; iris ring finger protein; muscle specific ring finger protein 2; muscle-specific RING finger protein 1; ring finger protein 28; striated muscle RING zinc finger protein; tripartite motif-containing protein 63
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM63
UniProt Gene Name
TRIM63
UniProt Synonym Gene Names
IRF; MURF1; RNF28; SMRZ; MuRF-1; MuRF1
UniProt Entry Name
TRI63_HUMAN

Uniprot Description

MURF1: E3 ubiquitin ligase. Regulates proteasomal degradation of cardiac troponin I/TNNI3 and probably of other sarcomeric- associated proteins. May play a role in striated muscle atrophy and hypertrophy by regulating an anti-hypertrophic PKC-mediated signaling pathway. May regulate the organization of myofibrils through TTN in muscle cells.

Protein type: EC 6.3.2.-; Ligase; EC 6.3.2.19; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 1p34-p33

Cellular Component: microtubule; cytoplasm; M band; Z disc; nucleus

Molecular Function: signal transducer activity; protein binding; zinc ion binding; ubiquitin-protein ligase activity; titin binding; ligase activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; skeletal muscle atrophy; muscle contraction; regulation of gene expression; protein ubiquitination; response to electrical stimulus involved in regulation of muscle adaptation; signal transduction

Similar Products

Product Notes

The TRIM63 trim63 (Catalog #AAA6144934) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRIM63 (E3 Ubiquitin-protein Ligase TRIM63, Iris RING Finger Protein, Muscle-specific RING Finger Protein 1, MuRF-1, MuRF1, RING Finger Protein 28, Striated Muscle RING Zinc Finger Protein, Tripartite Motif-containing Protein 63, IRF, MURF1, RNF28, SMRZ) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM63 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM63 trim63 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM63, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.