Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TRIM33 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse TRIM33 Monoclonal Antibody | anti-TRIM33 antibody

TRIM33 (Tripartite Motif-Containing 33, FLJ32925, PTC7, RFG7, TF1G, TIF1G, TIF1GAMMA, TIFGAMMA) (APC)

Gene Names
TRIM33; ECTO; PTC7; RFG7; TF1G; TIF1G; TIFGAMMA; TIF1GAMMA
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
TRIM33; Monoclonal Antibody; TRIM33 (Tripartite Motif-Containing 33; FLJ32925; PTC7; RFG7; TF1G; TIF1G; TIF1GAMMA; TIFGAMMA) (APC); Tripartite Motif-Containing 33; TIFGAMMA; anti-TRIM33 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6F4
Specificity
Recognizes TRIM33.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TRIM33 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TRIM33 (NP_056990, 1006aa-1105aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TRIM33 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TRIM33 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TRIM33 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TRIM33 on HeLa cell. [antibody concentration 10 ug/ml])

Western Blot (WB)

(TRIM33 monoclonal antibody (M02), clone 6F4 Western Blot analysis of TRIM33 expression in Hela S3 NE.)

Western Blot (WB) (TRIM33 monoclonal antibody (M02), clone 6F4 Western Blot analysis of TRIM33 expression in Hela S3 NE.)
Related Product Information for anti-TRIM33 antibody
The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined. [provided by RefSeq]
Product Categories/Family for anti-TRIM33 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 70; 124 kDa

Observed: 70 kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM33 isoform alpha
NCBI Official Synonym Full Names
tripartite motif containing 33
NCBI Official Symbol
TRIM33
NCBI Official Synonym Symbols
ECTO; PTC7; RFG7; TF1G; TIF1G; TIFGAMMA; TIF1GAMMA
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM33; TIF1-gamma; protein Rfg7; ectodermin homolog; RET-fused gene 7 protein; tripartite motif-containing 33; transcriptional intermediary factor 1 gamma
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM33
UniProt Gene Name
TRIM33
UniProt Synonym Gene Names
KIAA1113; RFG7; TIF1G; Protein Rfg7; TIF1-gamma
UniProt Entry Name
TRI33_HUMAN

NCBI Description

The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

TIF1G: an atypical protein kinase that functions as a transcriptional repressor. Translocation with RET generates the TRIM33/RET (PTC7) oncogene. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Two splice variant isoforms have been described.

Protein type: Ubiquitin ligase; Transcription, coactivator/corepressor; EC 6.3.2.19; Protein kinase, atypical; Ubiquitin conjugating system; EC 6.3.2.-; Ligase; Kinase, protein; ATYPICAL group; TIF1 family

Chromosomal Location of Human Ortholog: 1p13.1

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: transcription initiation from RNA polymerase II promoter; regulation of transforming growth factor beta receptor signaling pathway; transcription, DNA-dependent; transforming growth factor beta receptor signaling pathway; protein ubiquitination; gene expression; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of BMP signaling pathway

Disease: Thyroid Carcinoma, Papillary

Research Articles on TRIM33

Similar Products

Product Notes

The TRIM33 trim33 (Catalog #AAA6166317) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TRIM33 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM33 trim33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM33, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.