Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged RFP2 is ~0.1ng/ml as a capture antibody.)

Mouse anti-Human TRIM13 Monoclonal Antibody | anti-TRIM13 antibody

TRIM13 (LEU5, RFP2, RNF77, E3 Ubiquitin-protein Ligase TRIM13, B Cell Chronic Lymphocytic Leukemia Tumor Suppressor Leu5, Leukemia-associated Protein 5, Putative Tumor Suppressor RFP2, RING Finger Protein 77, Ret Finger Protein 2, Tripartite Motif-contain

Gene Names
TRIM13; CAR; LEU5; RFP2; DLEU5; RNF77
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRIM13; Monoclonal Antibody; TRIM13 (LEU5; RFP2; RNF77; E3 Ubiquitin-protein Ligase TRIM13; B Cell Chronic Lymphocytic Leukemia Tumor Suppressor Leu5; Leukemia-associated Protein 5; Putative Tumor Suppressor RFP2; RING Finger Protein 77; Ret Finger Protein 2; Tripartite Motif-contain; anti-TRIM13 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a, lambda
Clone Number
2A11
Specificity
Recognizes human RFP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
6720
Applicable Applications for anti-TRIM13 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from RFP2 (NP_005789) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RFP2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RFP2 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-TRIM13 antibody
This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This gene is located on chromosome 13 within the minimal deletion region for B-cell chronic lymphocytic leukemia. Multiple alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for anti-TRIM13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens tripartite motif containing 13 (TRIM13), transcript variant 1, mRNA
NCBI Official Synonym Full Names
tripartite motif containing 13
NCBI Official Symbol
TRIM13
NCBI Official Synonym Symbols
CAR; LEU5; RFP2; DLEU5; RNF77
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM13
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM13
UniProt Gene Name
TRIM13
UniProt Synonym Gene Names
LEU5; RFP2; RNF77
UniProt Entry Name
TRI13_HUMAN

NCBI Description

This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This gene is located on chromosome 13 within the minimal deletion region for B-cell chronic lymphocytic leukemia. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

TRIM13: E3 ubiquitin ligase involved in the retrotranslocation and turnover of membrane and secretory proteins from the ER through a set of processes named ER-associated degradation (ERAD). This process acts on misfolded proteins as well as in the regulated degradation of correctly folded proteins. Enhances ionizing radiation-induced p53/TP53 stability and apoptosis via ubiquitinating MDM2 and AKT1 and decreasing AKT1 kinase activity through MDM2 and AKT1 proteasomal degradation. Regulates ER stress-induced autophagy, and may act as a tumor suppressor. Belongs to the TRIM/RBCC family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; Membrane protein, integral; EC 6.3.2.-; Ubiquitin ligase; Ubiquitin conjugating system; Tumor suppressor

Chromosomal Location of Human Ortholog: 13q14

Cellular Component: endoplasmic reticulum membrane; cytoplasm; integral to membrane

Molecular Function: protein binding; signal transducer activity; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; negative regulation of viral transcription; ER-associated protein catabolic process; anatomical structure morphogenesis; protein autoubiquitination; positive regulation of I-kappaB kinase/NF-kappaB cascade; response to gamma radiation; innate immune response; signal transduction; positive regulation of macroautophagy; activation of NF-kappaB transcription factor

Research Articles on TRIM13

Similar Products

Product Notes

The TRIM13 trim13 (Catalog #AAA6134311) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRIM13 (LEU5, RFP2, RNF77, E3 Ubiquitin-protein Ligase TRIM13, B Cell Chronic Lymphocytic Leukemia Tumor Suppressor Leu5, Leukemia-associated Protein 5, Putative Tumor Suppressor RFP2, RING Finger Protein 77, Ret Finger Protein 2, Tripartite Motif-contain reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM13 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM13 trim13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM13, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.