Testing Data
(Detection limit for recombinant GST tagged TRIB3 is 3 ng/ml as a capture antibody.)
Mouse TRIB3 Monoclonal Antibody | anti-TRIB3 antibody
TRIB3 (Tribbles Homolog 3 (Drosophila), C20orf97, NIPK, SINK, SKIP3, TRB3) (FITC)
Gene Names
TRIB3; NIPK; SINK; TRB3; SKIP3; C20orf97
Applications
Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
TRIB3; Monoclonal Antibody; TRIB3 (Tribbles Homolog 3 (Drosophila); C20orf97; NIPK; SINK; SKIP3; TRB3) (FITC); Tribbles Homolog 3 (Drosophila); TRB3; anti-TRIB3 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D7
Specificity
Recognizes TRIB3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
358
Applicable Applications for anti-TRIB3 antibody
Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TRIB3 (AAH27484, 56aa-145aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged TRIB3 is 3 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TRIB3 is 3 ng/ml as a capture antibody.)
Western Blot (WB)
(Western Blot analysis of TRIB3 expression in transfected 293T cell line by TRIB3 monoclonal antibody (M07), clone 3D7.Lane 1: TRIB3 transfected lysate (39.6 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of TRIB3 expression in transfected 293T cell line by TRIB3 monoclonal antibody (M07), clone 3D7.Lane 1: TRIB3 transfected lysate (39.6 KDa).Lane 2: Non-transfected lysate.)
Immunoprecipitation (IP)
(Immunoprecipitation of TRIB3 transfected lysate using anti-TRIB3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TRIB3 MaxPab rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of TRIB3 transfected lysate using anti-TRIB3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TRIB3 MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-TRIB3 antibody
The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. [provided by RefSeq]
Product Categories/Family for anti-TRIB3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Tribbles homolog 3 (Drosophila)
NCBI Official Synonym Full Names
tribbles pseudokinase 3
NCBI Official Symbol
TRIB3
NCBI Official Synonym Symbols
NIPK; SINK; TRB3; SKIP3; C20orf97
NCBI Protein Information
tribbles homolog 3
Protein Family
NCBI Description
The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, this protein can negatively regulate the cell survival serine-threonine kinase AKT1. Differential promoter usage and alternate splicing result in multiple transcript variants. [provided by RefSeq, Jul 2014]
Research Articles on TRIB3
Similar Products
Product Notes
The TRIB3 (Catalog #AAA6175385) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TRIB3 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIB3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIB3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
