Testing Data
(Detection limit for recombinant GST tagged TRIB2 is 1 ng/ml as a capture antibody.)
Mouse TRIB2 Monoclonal Antibody | anti-TRIB2 antibody
TRIB2 (Tribbles Homolog 2 (Drosophila), C5FW, GS3955, TRB2) (AP)
Applications
Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
TRIB2; Monoclonal Antibody; TRIB2 (Tribbles Homolog 2 (Drosophila); C5FW; GS3955; TRB2) (AP); Tribbles Homolog 2 (Drosophila); TRB2; anti-TRIB2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D11
Specificity
Recognizes TRIB2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
343
Applicable Applications for anti-TRIB2 antibody
Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TRIB2 (AAH02637, 1aa-343aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged TRIB2 is 1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TRIB2 is 1 ng/ml as a capture antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of TRIB2 transfected lysate using anti-TRIB2 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with TRIB2 MaxPab rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of TRIB2 transfected lysate using anti-TRIB2 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with TRIB2 MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-TRIB2 antibody
This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-TRIB2 antibody
NCBI and Uniprot Product Information
Similar Products
Product Notes
The TRIB2 (Catalog #AAA6164493) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TRIB2 can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIB2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
