Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TMEM1 monoclonal antibody, Western Blot analysis of TMEM1 expression in Hela NE.)

Mouse anti-Human TRAPPC10 Monoclonal Antibody | anti-TRAPPC10 antibody

TRAPPC10 (Trafficking Protein Particle Complex Subunit 10, Epilepsy Holoprosencephaly Candidate 1 Protein, EHOC1, EHOC-1, Protein GT334, Trafficking Protein Particle Complex Subunit TMEM1, Transport Protein Particle Subunit TMEM1, TRAPP Subunit TMEM1, TME

Gene Names
TRAPPC10; EHOC1; GT334; TMEM1; TRS30; EHOC-1; TRS130
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRAPPC10; Monoclonal Antibody; TRAPPC10 (Trafficking Protein Particle Complex Subunit 10; Epilepsy Holoprosencephaly Candidate 1 Protein; EHOC1; EHOC-1; Protein GT334; Trafficking Protein Particle Complex Subunit TMEM1; Transport Protein Particle Subunit TMEM1; TRAPP Subunit TMEM1; TME; TRS30; TRS130; anti-TRAPPC10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5B4
Specificity
Recognizes human TMEM1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1259
Applicable Applications for anti-TRAPPC10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1162-1258 from human TMEM1 (NP_003265) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TMEM1 monoclonal antibody, Western Blot analysis of TMEM1 expression in Hela NE.)

Western Blot (WB) (TMEM1 monoclonal antibody, Western Blot analysis of TMEM1 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of TMEM1 expression in transfected 293T cell line by TMEM1 monoclonal antibody. Lane 1: TMEM1 transfected lysate (142.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TMEM1 expression in transfected 293T cell line by TMEM1 monoclonal antibody. Lane 1: TMEM1 transfected lysate (142.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of TMEM1 over-expressed 293 cell line, cotransfected with TMEM1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TMEM1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of TMEM1 over-expressed 293 cell line, cotransfected with TMEM1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TMEM1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-TRAPPC10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
trafficking protein particle complex subunit 10 isoform a
NCBI Official Synonym Full Names
trafficking protein particle complex 10
NCBI Official Symbol
TRAPPC10
NCBI Official Synonym Symbols
EHOC1; GT334; TMEM1; TRS30; EHOC-1; TRS130
NCBI Protein Information
trafficking protein particle complex subunit 10
UniProt Protein Name
Trafficking protein particle complex subunit 10
UniProt Gene Name
TRAPPC10
UniProt Synonym Gene Names
EHOC1; TMEM1; EHOC-1; TRAPP subunit TMEM1
UniProt Entry Name
TPC10_HUMAN

NCBI Description

The protein encoded by this gene is a transmembrane protein found in the cis-Golgi complex. The encoded protein is part of the multisubunit transport protein particle (TRAPP) complex and may be involved in vesicular transport from the endoplasmic reticulum to the Golgi. Mutations in this gene could be responsible for the Unverricht-Lundborg type of progressive myoclonus epilepsy, or for autoimmune polyglandular disease type 1. [provided by RefSeq, Jul 2008]

Research Articles on TRAPPC10

Similar Products

Product Notes

The TRAPPC10 trappc10 (Catalog #AAA6144836) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRAPPC10 (Trafficking Protein Particle Complex Subunit 10, Epilepsy Holoprosencephaly Candidate 1 Protein, EHOC1, EHOC-1, Protein GT334, Trafficking Protein Particle Complex Subunit TMEM1, Transport Protein Particle Subunit TMEM1, TRAPP Subunit TMEM1, TME reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRAPPC10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRAPPC10 trappc10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRAPPC10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.