Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Transportin-1 Monoclonal Antibody | anti-TNPO1 antibody

Transportin-1 (Importin beta-2, Karyopherin beta-2, M9 Region Interaction Protein, MIP, TNPO1, KPNB2, MIP1, TRN)

Gene Names
TNPO1; MIP; TRN; IPO2; MIP1; KPNB2
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
Transportin-1; Monoclonal Antibody; Transportin-1 (Importin beta-2; Karyopherin beta-2; M9 Region Interaction Protein; MIP; TNPO1; KPNB2; MIP1; TRN); Anti -Transportin-1 (Importin beta-2; anti-TNPO1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G2
Specificity
Recognizes human TNPO1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
PDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWPDLLPKLCSLLDSED
Applicable Applications for anti-TNPO1 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa25-141 from human TNPO1 (NP_002261) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-TNPO1 antibody
TNPO1 comprises the beta subunit of the karyopherin receptor complex which interacts with nuclear localization signals to target nuclear proteins to the nucleus. The karyopherin receptor complex is a heterodimer of an alpha subunit which recognizes the nuclear localization signal and a beta subunit which docks the complex at nucleoporins.
Product Categories/Family for anti-TNPO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102,355 Da
NCBI Official Full Name
transportin-1 isoform 1
NCBI Official Synonym Full Names
transportin 1
NCBI Official Symbol
TNPO1
NCBI Official Synonym Symbols
MIP; TRN; IPO2; MIP1; KPNB2
NCBI Protein Information
transportin-1; importin 2; importin beta 2; importin beta-2; karyopherin beta-2; M9 region interaction protein; karyopherin (importin) beta 2
UniProt Protein Name
Transportin-1
Protein Family
UniProt Gene Name
TNPO1
UniProt Synonym Gene Names
KPNB2; MIP1; TRN; MIP
UniProt Entry Name
TNPO1_HUMAN

NCBI Description

This gene encodes the beta subunit of the karyopherin receptor complex which interacts with nuclear localization signals to target nuclear proteins to the nucleus. The karyopherin receptor complex is a heterodimer of an alpha subunit which recognizes the nuclear localization signal and a beta subunit which docks the complex at nucleoporins. Alternate splicing of this gene results in two transcript variants encoding different proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

KPNB2: Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran- dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Involved in nuclear import of M9- containing proteins. In vitro, binds directly to the M9 region of the heterogeneous nuclear ribonucleoproteins (hnRNP), A1 and A2 and mediates their nuclear import. Appears also to be involved in hnRNP A1/A2 nuclear export. Mediates the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones, and SRP19. In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev. Belongs to the importin beta family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Karyopherin; RNA-binding; Nuclear import

Chromosomal Location of Human Ortholog: 5q13.2

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: protein binding; nuclear localization sequence binding; Ran GTPase binding

Biological Process: viral reproduction; protein import into nucleus, translocation; organelle organization and biogenesis; gene expression

Research Articles on TNPO1

Similar Products

Product Notes

The TNPO1 tnpo1 (Catalog #AAA644313) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Transportin-1 (Importin beta-2, Karyopherin beta-2, M9 Region Interaction Protein, MIP, TNPO1, KPNB2, MIP1, TRN) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Transportin-1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the TNPO1 tnpo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PDTTIQRTVQ QKLEQLNQYP DFNNYLIFVL TKLKSEDEPT RSLSGLILKN NVKAHFQNFP NGVTDFIKSE CLNNIGDSSP LIRATVGILI TTIASKGELQ NWPDLLPKLC SLLDSED. It is sometimes possible for the material contained within the vial of "Transportin-1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.