Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.17kD).)

Mouse anti-Human TRAF3 Monoclonal Antibody | anti-TRAF3 antibody

TRAF3 (TNF Receptor-associated Factor 3, CAP1, CAP-1, CD40 Receptor-associated Factor 1, CRAF1, CD40-binding Protein, CD40BP, LMP1-associated Protein 1, LAP1, IIAE5) (Biotin)

Gene Names
TRAF3; CAP1; LAP1; CAP-1; CRAF1; IIAE5; CD40bp; RNF118
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRAF3; Monoclonal Antibody; TRAF3 (TNF Receptor-associated Factor 3; CAP1; CAP-1; CD40 Receptor-associated Factor 1; CRAF1; CD40-binding Protein; CD40BP; LMP1-associated Protein 1; LAP1; IIAE5) (Biotin); EC=6.3.2.-; anti-TRAF3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C5
Specificity
Recognizes human TRAF3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
7806
Applicable Applications for anti-TRAF3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa298-410 from human TRAF3 (NP_663777) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.17kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.17kD).)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between TRAF5 and TRAF3 HeLa cells were stained with TRAF5 rabbit purified polyclonal 1:1200 and TRAF3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)

Testing Data (Proximity Ligation Analysis of protein-protein interactions between TRAF5 and TRAF3 HeLa cells were stained with TRAF5 rabbit purified polyclonal 1:1200 and TRAF3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).)
Product Categories/Family for anti-TRAF3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens TNF receptor associated factor 3 (TRAF3), transcript variant 1, mRNA
NCBI Official Synonym Full Names
TNF receptor associated factor 3
NCBI Official Symbol
TRAF3
NCBI Official Synonym Symbols
CAP1; LAP1; CAP-1; CRAF1; IIAE5; CD40bp; RNF118
NCBI Protein Information
TNF receptor-associated factor 3
UniProt Protein Name
TNF receptor-associated factor 3
Protein Family
UniProt Gene Name
TRAF3
UniProt Synonym Gene Names
CAP1; CRAF1; CRAF1; CD40BP; LAP1
UniProt Entry Name
TRAF3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. Several alternatively spliced transcript variants encoding three distinct isoforms have been reported. [provided by RefSeq, Dec 2010]

Uniprot Description

TRAF3: Regulates pathways leading to the activation of NF- kappa-B and MAP kinases, and plays a central role in the regulation of B-cell survival. Part of signaling pathways leading to the production of cytokines and interferon. Required for normal antibody isotype switching from IgM to IgG. Plays a role T-cell dependent immune responses. Plays a role in the regulation of antiviral responses. Is an essential constituent of several E3 ubiquitin-protein ligase complexes. May have E3 ubiquitin-protein ligase activity and promote 'Lys-63'-linked ubiquitination of target proteins. Inhibits activation of NF-kappa-B in response to LTBR stimulation. Inhibits TRAF2-mediated activation of NF-kappa- B. Down-regulates proteolytic processing of NFKB2, and thereby inhibits non-canonical activation of NF-kappa-B. Promotes ubiquitination and proteasomal degradation of MAP3K14. Homotrimer. Heterotrimer with TRAF2 and TRAF5. Interacts with LTBR/TNFRSF3, TNFRSF4, TNFRSF5/CD40, TNFRSF8/CD30, TNFRSF13C TNFRSF17/BCMA, TLR4 and EDAR. Interacts with MAP3K5, MAP3K14, TRAIP/TRIP, TDP2/TTRAP, TANK/ITRAF and TRAF3IP1. Interaction with TNFRSF5/CD40 is modulated by TANK/ITRAF, which competes for the same binding site. Interacts with TICAM1. Interacts with TRAFD1. Interacts with OTUB1, OTUB2 and OTUD5. Interacts with RNF216, MAVS, OPTN and TBK1. Identified in a complex with TRAF2, MAP3K14 and BIRC3. Interacts with BIRC2 and BIRC3. Upon exposure to bacterial lipopolysaccharide (LPS), recruited to a transient complex containing TLR4, TRAF3, TRAF6, IKBKG, MAP3K7, MYD88, TICAM1, BIRC2, BIRC3 and UBE2N. Interacts with Epstein-Barr virus protein LMP1. Interacts (via RING-type zinc finger domain) with SRC. Belongs to the TNF receptor-associated factor family. A subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 14q32.32

Cellular Component: internal side of plasma membrane; mitochondrion; cytosol; endosome

Molecular Function: protein binding; signal transducer activity; zinc ion binding; thioesterase binding; ubiquitin protein ligase binding; ubiquitin-protein ligase activity; tumor necrosis factor receptor binding; protein kinase binding; ligase activity

Biological Process: apoptosis; MyD88-independent toll-like receptor signaling pathway; regulation of defense response to virus; protein ubiquitination; toll-like receptor 3 signaling pathway; signal transduction; Toll signaling pathway; regulation of cytokine production; regulation of apoptosis; tumor necrosis factor-mediated signaling pathway; inhibition of NF-kappaB transcription factor; regulation of proteolysis; toll-like receptor signaling pathway; innate immune response; regulation of interferon-beta production; toll-like receptor 4 signaling pathway; negative regulation of interferon type I production

Disease: Herpes Simplex Encephalitis, Susceptibility To, 3

Research Articles on TRAF3

Similar Products

Product Notes

The TRAF3 traf3 (Catalog #AAA6144899) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRAF3 (TNF Receptor-associated Factor 3, CAP1, CAP-1, CD40 Receptor-associated Factor 1, CRAF1, CD40-binding Protein, CD40BP, LMP1-associated Protein 1, LAP1, IIAE5) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRAF3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRAF3 traf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRAF3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.