Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SFRS10 expression in transfected 293T cell line by SFRS10 monoclonal antibody. Lane 1: SFRS10 transfected lysate (33.7kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human TRA2B Monoclonal Antibody | anti-TRA2B antibody

TRA2B (SFRS10, Transformer-2 Protein Homolog beta, Splicing Factor, Arginine/Serine-rich 10, TRA-2 beta, TRA2-beta, hTRA2-beta, Transformer-2 Protein Homolog B, DKFZp686F18120) (FITC)

Gene Names
TRA2B; SFRS10; SRFS10; TRAN2B; PPP1R156; TRA2-BETA; Htra2-beta
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TRA2B; Monoclonal Antibody; TRA2B (SFRS10; Transformer-2 Protein Homolog beta; Splicing Factor; Arginine/Serine-rich 10; TRA-2 beta; TRA2-beta; hTRA2-beta; Transformer-2 Protein Homolog B; DKFZp686F18120) (FITC); anti-TRA2B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
7A1
Specificity
Recognizes human SFRS10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-TRA2B antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa120-199 from SFRS10 (NP_004584) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRP
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SFRS10 expression in transfected 293T cell line by SFRS10 monoclonal antibody. Lane 1: SFRS10 transfected lysate (33.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SFRS10 expression in transfected 293T cell line by SFRS10 monoclonal antibody. Lane 1: SFRS10 transfected lysate (33.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SFRS10 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SFRS10 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of SFRS10 over-expressed 293 cell line, cotransfected with SFRS10 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SFRS10 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of SFRS10 over-expressed 293 cell line, cotransfected with SFRS10 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SFRS10 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-TRA2B antibody
TRA2B is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.
Product Categories/Family for anti-TRA2B antibody
References
1. Multiple therapeutic effects of valproic acid in spinal muscular atrophy model mice. Tsai LK, Tsai MS, Ting CH, Li H.J Mol Med. 2008 Nov;86(11):1243-54. Epub 2008 Jul 23.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
transformer-2 protein homolog beta isoform 2
NCBI Official Synonym Full Names
transformer 2 beta homolog
NCBI Official Symbol
TRA2B
NCBI Official Synonym Symbols
SFRS10; SRFS10; TRAN2B; PPP1R156; TRA2-BETA; Htra2-beta
NCBI Protein Information
transformer-2 protein homolog beta
UniProt Protein Name
Serine protease HTRA2, mitochondrial
Protein Family
UniProt Gene Name
HTRA2
UniProt Synonym Gene Names
OMI; PRSS25; HtrA2
UniProt Entry Name
HTRA2_HUMAN

NCBI Description

This gene encodes a nuclear protein which functions as sequence-specific serine/arginine splicing factor which plays a role in mRNA processing, splicing patterns, and gene expression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011]

Uniprot Description

HTRA2: a serine proteinase that normally resides in mitochondrial membranes. It exists in two populations in mitochondria: as an unprocessed form probably attached to the inner mitochondrial membrane through a N-terminal transmembrane domain, and as a processed form containing a reaper motif at its N-terminus. Following apoptotic stimuli it is autoproteolytically activated and released into the cytosol, where it promotes programmed cell death in caspase-dependent and -independent manners. The amino-terminal reaper motif binds to the IAP (inhibitor of apoptosis) proteins cIAP1, cIAP2, and and XIAP, disrupting IAP-caspase complexes in a manner similar to Smac/DIABLO. Phosphorylation by the protein kinase Akt attenuates its serine protease and pro-apoptotic activities. The PDZ domain mediates interaction with Mxi2, an alternatively spliced form of the p38 stress-activated kinase. In contrast to its pro-apoptotic effects, targeted deletion in mice indicates that it is involved in protection against cell stress in striatial neurons. Defects in HTRA2 are the cause of Parkinson disease 13 (PARK13). Four alternatively spliced human isoforms have been described.

Protein type: Membrane protein, integral; EC 3.4.21.108; Mitochondrial; Protease

Chromosomal Location of Human Ortholog: 2p12

Cellular Component: endoplasmic reticulum membrane; internal side of plasma membrane; cytoskeleton; membrane; mitochondrion; endoplasmic reticulum; mitochondrial membrane; mitochondrial intermembrane space; cytosol; nucleus; chromatin

Molecular Function: peptidase activity; protein binding; serine-type peptidase activity; serine-type endopeptidase activity; unfolded protein binding

Biological Process: mitochondrion organization and biogenesis; positive regulation of apoptosis; regulation of multicellular organism growth; positive regulation of caspase activity; response to herbicide; proteolysis; adult walking behavior; negative regulation of cell cycle; protein autoprocessing; DNA damage response, signal transduction resulting in induction of apoptosis; pentacyclic triterpenoid metabolic process; cellular protein catabolic process; forebrain development; neuron development; ceramide metabolic process

Disease: Parkinson Disease 13, Autosomal Dominant, Susceptibility To

Research Articles on TRA2B

Similar Products

Product Notes

The TRA2B htra2 (Catalog #AAA6150198) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRA2B (SFRS10, Transformer-2 Protein Homolog beta, Splicing Factor, Arginine/Serine-rich 10, TRA-2 beta, TRA2-beta, hTRA2-beta, Transformer-2 Protein Homolog B, DKFZp686F18120) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRA2B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRA2B htra2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRA2B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.