<
Western Blot (WB)
(Western Blot detection against Immunogen (37.18kD).)
Mouse anti-Human TPT1 Monoclonal Antibody | anti-TPT1 antibody
TPT1 (Translationally-controlled tumor protein, TCTP, p23, Histamine-releasing Factor, HRF, Fortilin) (Biotin)
Gene Names
TPT1; HRF; p02; p23; TCTP
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TPT1; Monoclonal Antibody; TPT1 (Translationally-controlled tumor protein; TCTP; p23; Histamine-releasing Factor; HRF; Fortilin) (Biotin); anti-TPT1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C7
Specificity
Recognizes human TPT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-TPT1 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 30ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa35-138 from human TPT1 (AAH22436) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.18kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.18kD).)
Western Blot (WB)
(TPT1 monoclonal antibody. Western Blot analysis of TPT1 expression in HepG2.)
Western Blot (WB)
(TPT1 monoclonal antibody. Western Blot analysis of TPT1 expression in HepG2.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TPT1 on HeLa cell. [antibody concentration 30ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TPT1 on HeLa cell. [antibody concentration 30ug/ml])
Testing Data
(Detection limit for recombinant GST tagged TPT1 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TPT1 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-TPT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
15,597 Da
NCBI Official Full Name
Homo sapiens tumor protein, translationally-controlled 1, mRNA
NCBI Official Synonym Full Names
tumor protein, translationally-controlled 1
NCBI Official Symbol
TPT1
NCBI Official Synonym Symbols
HRF; p02; p23; TCTP
NCBI Protein Information
translationally-controlled tumor protein
Protein Family
Research Articles on TPT1
Similar Products
Product Notes
The TPT1 (Catalog #AAA6144892) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TPT1 (Translationally-controlled tumor protein, TCTP, p23, Histamine-releasing Factor, HRF, Fortilin) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TPT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 30ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TPT1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TPT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
