Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD))

Mouse anti-Human TPP1 Monoclonal Antibody | anti-TPP1 antibody

TPP1 (Tripeptidyl-peptidase 1, TPP-1, Cell Growth-inhibiting Gene 1 Protein, Lysosomal Pepstatin-insensitive Protease, LPIC, Tripeptidyl Aminopeptidase, Tripeptidyl-peptidase I, TPP-I, CLN2, GIG1, UNQ267/PRO304) (AP)

Gene Names
TPP1; CLN2; GIG1; LPIC; SCAR7; TPP-1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TPP1; Monoclonal Antibody; TPP1 (Tripeptidyl-peptidase 1; TPP-1; Cell Growth-inhibiting Gene 1 Protein; Lysosomal Pepstatin-insensitive Protease; LPIC; Tripeptidyl Aminopeptidase; Tripeptidyl-peptidase I; TPP-I; CLN2; GIG1; UNQ267/PRO304) (AP); anti-TPP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B1
Specificity
Recognizes human TPP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TPP1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa195-304 from human TPP1 (AAH14863) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHEGQEPF
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD))

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD))

Western Blot (WB)

(TPP1, Western Blot analysis of TPP1 expression in A-431.)

Western Blot (WB) (TPP1, Western Blot analysis of TPP1 expression in A-431.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TPP1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TPP1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged TPP1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TPP1 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-TPP1 antibody
References
1. Altered expression of TPP1 in fibroblast-like synovial cells might be involved in the pathogenesis of rheumatoid arthritis. Qing YF, Zhou JG, Zhao MC, Xie WG, Yang QB, Xing Y, Zeng SP, Jiang H.Rheumatol Int. 2011 Jul 16.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
34,464 Da
NCBI Official Full Name
Homo sapiens tripeptidyl peptidase I, mRNA
NCBI Official Synonym Full Names
tripeptidyl peptidase 1
NCBI Official Symbol
TPP1
NCBI Official Synonym Symbols
CLN2; GIG1; LPIC; SCAR7; TPP-1
NCBI Protein Information
tripeptidyl-peptidase 1
Protein Family

NCBI Description

This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome. [provided by RefSeq, Jul 2008]

Research Articles on TPP1

Similar Products

Product Notes

The TPP1 (Catalog #AAA6134282) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TPP1 (Tripeptidyl-peptidase 1, TPP-1, Cell Growth-inhibiting Gene 1 Protein, Lysosomal Pepstatin-insensitive Protease, LPIC, Tripeptidyl Aminopeptidase, Tripeptidyl-peptidase I, TPP-I, CLN2, GIG1, UNQ267/PRO304) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TPP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TPP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TPP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.