Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (53.02kD).)

Mouse anti-Human TPM4 Monoclonal Antibody | anti-TPM4 antibody

TPM4 (Tropomyosin alpha-4 chain, TM30p1, Tropomyosin-4) (HRP)

Gene Names
TPM4; HEL-S-108
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TPM4; Monoclonal Antibody; TPM4 (Tropomyosin alpha-4 chain; TM30p1; Tropomyosin-4) (HRP); anti-TPM4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4E4-1D2
Specificity
Recognizes human TPM4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-TPM4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 2ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-248 from human TPM4 (AAH37576) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (53.02kD).)

Western Blot (WB) (Western Blot detection against Immunogen (53.02kD).)

Western Blot (WB)

(TPM4 monoclonal antibody. Western Blot analysis of TPM4 expression in Hela.)

Western Blot (WB) (TPM4 monoclonal antibody. Western Blot analysis of TPM4 expression in Hela.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TPM4 on formalin-fixed paraffin-embedded human transitional cell carcinoma tissue. [antibody concentration 2ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TPM4 on formalin-fixed paraffin-embedded human transitional cell carcinoma tissue. [antibody concentration 2ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TPM4 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TPM4 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TPM4 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TPM4 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-TPM4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
32,723 Da
NCBI Official Full Name
Homo sapiens tropomyosin 4, mRNA
NCBI Official Synonym Full Names
tropomyosin 4
NCBI Official Symbol
TPM4
NCBI Official Synonym Symbols
HEL-S-108
NCBI Protein Information
tropomyosin alpha-4 chain
Protein Family

NCBI Description

This gene encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosins are dimers of coiled-coil proteins that polymerize end-to-end along the major groove in most actin filaments. They provide stability to the filaments and regulate access of other actin-binding proteins. In muscle cells, they regulate muscle contraction by controlling the binding of myosin heads to the actin filament. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2009]

Research Articles on TPM4

Similar Products

Product Notes

The TPM4 (Catalog #AAA6155492) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TPM4 (Tropomyosin alpha-4 chain, TM30p1, Tropomyosin-4) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TPM4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 2ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TPM4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TPM4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.