Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human TP53BP1 Monoclonal Antibody | anti-TP53BP1 antibody

TP53BP1 (Tumor Suppressor p53-binding Protein 1, 53BP1, p53-binding Protein 1, p53BP1, p202) (MaxLight 750)

Gene Names
TP53BP1; p202; 53BP1; TDRD30; p53BP1
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TP53BP1; Monoclonal Antibody; TP53BP1 (Tumor Suppressor p53-binding Protein 1; 53BP1; p53-binding Protein 1; p53BP1; p202) (MaxLight 750); anti-TP53BP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B9
Specificity
Recognizes human TP53BP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
10520
Applicable Applications for anti-TP53BP1 antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1766-1874 from human TP53BP1 (NP_005648) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKV
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TP53BP1 antibody
MaxLight750 is a new Near IR stable dye conjugate comparable to DyLight750, Alexa Fluor700 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (759nm); Emission (780nm); Extinction Coefficient 240,000.
Product Categories/Family for anti-TP53BP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens tumor protein p53 binding protein 1 (TP53BP1), transcript variant 3, mRNA
NCBI Official Synonym Full Names
tumor protein p53 binding protein 1
NCBI Official Symbol
TP53BP1
NCBI Official Synonym Symbols
p202; 53BP1; TDRD30; p53BP1
NCBI Protein Information
TP53-binding protein 1
UniProt Protein Name
Tumor suppressor p53-binding protein 1
UniProt Gene Name
TP53BP1
UniProt Synonym Gene Names
53BP1; p53-binding protein 1; p53BP1
UniProt Entry Name
TP53B_HUMAN

NCBI Description

This gene encodes a protein that functions in the DNA double-strand break repair pathway choice, promoting non-homologous end joining (NHEJ) pathways, and limiting homologous recombination. This protein plays multiple roles in the DNA damage response, including promoting checkpoint signaling following DNA damage, acting as a scaffold for recruitment of DNA damage response proteins to damaged chromatin, and promoting NHEJ pathways by limiting end resection following a double-strand break. These roles are also important during V(D)J recombination, class switch recombination and at unprotected telomeres. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2017]

Uniprot Description

53BP1: a DNA damage checkpoint protein that interacts with HDAC4 protein to mediate the DNA damage response. Inhibits E2F1-mediated apoptosis in prostate cancer cells. Recruited to double strand breaks via the binding of its Tudor domain to dimethylated H3 K20. Asymmetrically dimethylated on Arg residues by PRMT1. Methylation is required for DNA binding. Binds to the central domain of p53. Interacts with Artemis. Interacts with histone H2AFX and this requires phosphorylation of H2AFX on S139. Interacts with histone H4 that has been dimethylated at K20. Has low affinity for histone H4 containing monomethylated K20. Does not bind histone H4 containing unmethylated or trimethylated K20. Has low affinity for histone H3 that has been dimethylated on K79. Does not bind unmethylated histone H3. Phosphorylated at basal level in the absence of DNA damage. Hyper-phosphorylated in an ATM-dependent manner in response to DNA damage induced by ionizing radiation. Hyper-phosphorylated in an ATR-dependent manner in response to DNA damage induced by UV irradiation. Two alternatively spliced human isoforms have been observed.

Protein type: DNA repair, damage; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 15q15-q21

Cellular Component: nucleoplasm; chromosome, telomeric region; cytoplasm; replication fork; nucleus

Molecular Function: protein binding; p53 binding; telomeric DNA binding; damaged DNA binding; methylated histone residue binding

Biological Process: transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; double-strand break repair; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; DNA repair; response to DNA damage stimulus; double-strand break repair via homologous recombination

Research Articles on TP53BP1

Similar Products

Product Notes

The TP53BP1 tp53bp1 (Catalog #AAA6235837) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TP53BP1 (Tumor Suppressor p53-binding Protein 1, 53BP1, p53-binding Protein 1, p53BP1, p202) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TP53BP1 can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TP53BP1 tp53bp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TP53BP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.