Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (41.73kD).)

Mouse TOMM22 Monoclonal Antibody | anti-TOMM22 antibody

TOMM22 (Translocase of Outer Membrane 22kD Subunit Homolog, Mitochondrial Import Receptor Subunit TOM22 Homolog, TOM22, hTom22, 1C9-2, MST065, MSTP065) (Biotin)

Gene Names
TOMM22; 1C9-2; TOM22; MST065; MSTP065
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TOMM22; Monoclonal Antibody; TOMM22 (Translocase of Outer Membrane 22kD Subunit Homolog; Mitochondrial Import Receptor Subunit TOM22 Homolog; TOM22; hTom22; 1C9-2; MST065; MSTP065) (Biotin); anti-TOMM22 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G4
Specificity
Recognizes human TOMM22. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-TOMM22 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-143 from human TOMM22 (AAH09363) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (41.73kD).)

Western Blot (WB) (Western Blot detection against Immunogen (41.73kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TOMM22 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TOMM22 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TOMM22 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TOMM22 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TOMM22 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TOMM22 is 0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of TOMM22 over-expressed 293 cell line, cotransfected with TOMM22 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TOMM22 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of TOMM22 over-expressed 293 cell line, cotransfected with TOMM22 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TOMM22 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(TOMM22 monoclonal antibody. Western Blot analysis of TOMM22 expression in PC-12.)

Western Blot (WB) (TOMM22 monoclonal antibody. Western Blot analysis of TOMM22 expression in PC-12.)

Western Blot (WB)

(Western Blot analysis of TOMM22 expression in transfected 293T cell line by TOMM22 monoclonal antibody. Lane 1: TOMM22 transfected lysate (15.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TOMM22 expression in transfected 293T cell line by TOMM22 monoclonal antibody. Lane 1: TOMM22 transfected lysate (15.5kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TOMM22 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
15,522 Da
NCBI Official Full Name
Homo sapiens translocase of outer mitochondrial membrane 22 homolog (yeast), mRNA
NCBI Official Synonym Full Names
translocase of outer mitochondrial membrane 22
NCBI Official Symbol
TOMM22
NCBI Official Synonym Symbols
1C9-2; TOM22; MST065; MSTP065
NCBI Protein Information
mitochondrial import receptor subunit TOM22 homolog

NCBI Description

The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. [provided by RefSeq, Jul 2008]

Research Articles on TOMM22

Similar Products

Product Notes

The TOMM22 (Catalog #AAA6144874) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TOMM22 (Translocase of Outer Membrane 22kD Subunit Homolog, Mitochondrial Import Receptor Subunit TOM22 Homolog, TOM22, hTom22, 1C9-2, MST065, MSTP065) (Biotin) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TOMM22 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TOMM22 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TOMM22, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.