Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged TNFRSF8 is approximately 0.03ng/ml as a capture antibody.)

Mouse TNFRSF8 Monoclonal Antibody | anti-TNFRSF8 antibody

TNFRSF8 (Tumor Necrosis Factor Receptor Superfamily, Member 8, CD30, D1S166E, KI-1) (Biotin)

Gene Names
TNFRSF8; CD30; Ki-1; D1S166E
Applications
ELISA
Purity
Purified
Synonyms
TNFRSF8; Monoclonal Antibody; TNFRSF8 (Tumor Necrosis Factor Receptor Superfamily; Member 8; CD30; D1S166E; KI-1) (Biotin); Tumor Necrosis Factor Receptor Superfamily; KI-1; anti-TNFRSF8 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B9
Specificity
Recognizes TNFRSF8.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-TNFRSF8 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TNFRSF8 (NP_001234, 21aa-133aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPA
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TNFRSF8 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TNFRSF8 is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-TNFRSF8 antibody
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq]
Product Categories/Family for anti-TNFRSF8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
943
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39.5kDa (370aa) 40-57KDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 8 isoform 1
NCBI Official Synonym Full Names
TNF receptor superfamily member 8
NCBI Official Symbol
TNFRSF8
NCBI Official Synonym Symbols
CD30; Ki-1; D1S166E
NCBI Protein Information
tumor necrosis factor receptor superfamily member 8
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 8
UniProt Gene Name
TNFRSF8
UniProt Synonym Gene Names
CD30; D1S166E
UniProt Entry Name
TNR8_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFRSF8: Receptor for TNFSF8/CD30L. May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF- kappa-B. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 1p36

Cellular Component: integral to plasma membrane

Molecular Function: transmembrane receptor activity; tumor necrosis factor receptor activity

Biological Process: immune response; inflammatory response; multicellular organismal development; negative regulation of cell proliferation; positive regulation of apoptosis; positive regulation of TRAIL biosynthetic process; positive regulation of tumor necrosis factor biosynthetic process; response to lipopolysaccharide; signal transduction

Research Articles on TNFRSF8

Similar Products

Product Notes

The TNFRSF8 tnfrsf8 (Catalog #AAA6170359) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TNFRSF8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TNFRSF8 tnfrsf8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TNFRSF8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.