Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged TNFRSF14 is ~0.03ng/ml as a capture antibody.)

Mouse anti-Human TNFRSF14 Monoclonal Antibody | anti-TNFRSF14 antibody

TNFRSF14 (HVEM, TR2, Tumor Necrosis Factor Receptor Superfamily Member 14, Herpes Virus Entry Mediator A, Herpes virus Entry Mediator A, HveA, Tumor Necrosis Factor Receptor-like 2, CD270, HVEA, UNQ329/PRO509) (AP)

Gene Names
TNFRSF14; TR2; ATAR; HVEA; HVEM; CD270; LIGHTR
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TNFRSF14; Monoclonal Antibody; TNFRSF14 (HVEM; TR2; Tumor Necrosis Factor Receptor Superfamily Member 14; Herpes Virus Entry Mediator A; Herpes virus Entry Mediator A; HveA; Tumor Necrosis Factor Receptor-like 2; CD270; HVEA; UNQ329/PRO509) (AP); anti-TNFRSF14 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G6-2C7
Specificity
Recognizes human TNFRSF14.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TNFRSF14 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa38-284 from TNFRSF14 (AAH02794) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TNFRSF14 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TNFRSF14 is ~0.03ng/ml as a capture antibody.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TNFRSF14 on formalin-fixed paraffin-embedded human pancreatic cancer. [antibody concentration 1ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TNFRSF14 on formalin-fixed paraffin-embedded human pancreatic cancer. [antibody concentration 1ug/ml].)

Western Blot (WB)

(Western Blot analysis of TNFRSF14 expression in transfected 293T cell line by TNFRSF14 monoclonal antibody Lane 1: TNFRSF14 transfected lysate (30.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TNFRSF14 expression in transfected 293T cell line by TNFRSF14 monoclonal antibody Lane 1: TNFRSF14 transfected lysate (30.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western Blot detection against Immunogen (53.17kD).)

Western Blot (WB) (Western Blot detection against Immunogen (53.17kD).)
Product Categories/Family for anti-TNFRSF14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
30,392 Da
NCBI Official Full Name
Homo sapiens tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator), mRNA
NCBI Official Synonym Full Names
tumor necrosis factor receptor superfamily, member 14
NCBI Official Symbol
TNFRSF14
NCBI Official Synonym Symbols
TR2; ATAR; HVEA; HVEM; CD270; LIGHTR
NCBI Protein Information
tumor necrosis factor receptor superfamily member 14; CD40-like protein; herpesvirus entry mediator A; herpes virus entry mediator A; tumor necrosis factor receptor-like 2; tumor necrosis factor receptor-like gene2; tumor necrosis factor receptor superfam
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 14
UniProt Gene Name
TNFRSF14
UniProt Synonym Gene Names
HVEA; HVEM; Herpesvirus entry mediator A; HveA; TR2
UniProt Entry Name
TNR14_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor was identified as a cellular mediator of herpes simplex virus (HSV) entry. Binding of HSV viral envelope glycoprotein D (gD) to this receptor protein has been shown to be part of the viral entry mechanism. The cytoplasmic region of this receptor was found to bind to several TRAF family members, which may mediate the signal transduction pathways that activate the immune response. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFRSF14: Receptor for BTLA. Receptor for TNFSF14/LIGHT and homotrimeric TNFSF1/lymphotoxin-alpha. Involved in lymphocyte activation. Plays an important role in HSV pathogenesis because it enhanced the entry of several wild-type HSV strains of both serotypes into CHO cells, and mediated HSV entry into activated human T-cells.

Protein type: Receptor, misc.; Membrane protein, integral; Cell cycle regulation

Chromosomal Location of Human Ortholog: 1p36.32

Cellular Component: integral to plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: viral receptor activity; protein binding; tumor necrosis factor receptor activity; ubiquitin protein ligase binding

Biological Process: positive regulation of peptidyl-tyrosine phosphorylation; defense response to Gram-positive bacterium; entry of virus into host cell; cell surface receptor linked signal transduction; tumor necrosis factor-mediated signaling pathway; T cell costimulation; positive regulation of cytokine secretion during immune response; negative regulation of alpha-beta T cell proliferation; immune response; defense response to Gram-negative bacterium

Research Articles on TNFRSF14

Similar Products

Product Notes

The TNFRSF14 tnfrsf14 (Catalog #AAA6134242) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TNFRSF14 (HVEM, TR2, Tumor Necrosis Factor Receptor Superfamily Member 14, Herpes Virus Entry Mediator A, Herpes virus Entry Mediator A, HveA, Tumor Necrosis Factor Receptor-like 2, CD270, HVEA, UNQ329/PRO509) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNFRSF14 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TNFRSF14 tnfrsf14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TNFRSF14, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.