Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged TM9SF2 is 0.03ng/ml as a capture antibody.)

Mouse anti-Human TM9SF2 Monoclonal Antibody | anti-TM9SF2 antibody

TM9SF2 (Transmembrane 9 Superfamily Member 2, p76)

Gene Names
TM9SF2; P76
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TM9SF2; Monoclonal Antibody; TM9SF2 (Transmembrane 9 Superfamily Member 2; p76); Anti -TM9SF2 (Transmembrane 9 Superfamily Member 2; anti-TM9SF2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1C2
Specificity
Recognizes human TM9SF2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
KKETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRFCNPGFPIGCYITDKGHAKDACVISSDFHERDTFYIFNHVDIK
Applicable Applications for anti-TM9SF2 antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa116-215 from TM9SF2 (NP_004791) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TM9SF2 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TM9SF2 is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-TM9SF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,776 Da
NCBI Official Full Name
transmembrane 9 superfamily member 2
NCBI Official Synonym Full Names
transmembrane 9 superfamily member 2
NCBI Official Symbol
TM9SF2
NCBI Official Synonym Symbols
P76
NCBI Protein Information
transmembrane 9 superfamily member 2; 76 kDa membrane protein; transmembrane protein 9 superfamily member 2
UniProt Protein Name
Transmembrane 9 superfamily member 2
UniProt Gene Name
TM9SF2
UniProt Entry Name
TM9S2_HUMAN

NCBI Description

This gene encodes a member of the transmembrane 9 superfamily. The encoded 76 kDa protein localizes to early endosomes in human cells. The encoded protein possesses a conserved and highly hydrophobic C-terminal domain which contains nine transmembrane domains. The protein may play a role in small molecule transport or act as an ion channel. A pseudogene associated with this gene is located on the X chromosome. [provided by RefSeq, Oct 2012]

Uniprot Description

TM9SF2: In the intracellular compartments, may function as a channel or small molecule transporter. Belongs to the nonaspanin (TM9SF) family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q32.3

Cellular Component: integral to plasma membrane; endosome membrane; endosome

Biological Process: transport

Research Articles on TM9SF2

Similar Products

Product Notes

The TM9SF2 tm9sf2 (Catalog #AAA6006371) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TM9SF2 (Transmembrane 9 Superfamily Member 2, p76) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TM9SF2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the TM9SF2 tm9sf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KKETCKLVCT KTYHTEKAED KQKLEFLKKS MLLNYQHHWI VDNMPVTWCY DVEDGQRFCN PGFPIGCYIT DKGHAKDACV ISSDFHERDT FYIFNHVDIK. It is sometimes possible for the material contained within the vial of "TM9SF2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.