Western Blot (WB)
(TLR7 monoclonal antibody (M07), clone 4G6. Western Blot analysis of TLR7 expression in Daoy.)
Mouse TLR7 Monoclonal Antibody | anti-TLR7 antibody
TLR7 (Toll-like Receptor 7) (HRP)
Gene Names
TLR7; TLR7-like
Applications
Western Blot
Purity
Purified
Synonyms
TLR7; Monoclonal Antibody; TLR7 (Toll-like Receptor 7) (HRP); Toll-like Receptor 7; anti-TLR7 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G6
Specificity
Recognizes TLR7.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-TLR7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TLR7 (NP_057646, 27aa-126aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(TLR7 monoclonal antibody (M07), clone 4G6. Western Blot analysis of TLR7 expression in Daoy.)
Western Blot (WB)
(TLR7 monoclonal antibody (M07), clone 4G6. Western Blot analysis of TLR7 expression in Daoy.)
Testing Data
(Detection limit for recombinant GST tagged TLR7 is approximately 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TLR7 is approximately 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-TLR7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
120,922 Da
NCBI Official Full Name
toll-like receptor 7
NCBI Official Synonym Full Names
toll like receptor 7
NCBI Official Symbol
TLR7
NCBI Official Synonym Symbols
TLR7-like
NCBI Protein Information
toll-like receptor 7
UniProt Protein Name
Toll-like receptor 7
Protein Family
UniProt Gene Name
TLR7
UniProt Entry Name
TLR7_HUMAN
NCBI Description
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is predominantly expressed in lung, placenta, and spleen, and lies in close proximity to another family member, TLR8, on chromosome X. [provided by RefSeq, Jul 2008]
Research Articles on TLR7
Similar Products
Product Notes
The TLR7 tlr7 (Catalog #AAA6179543) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TLR7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TLR7 tlr7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TLR7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
