Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TLR5 monoclonal antibody (M10), clone 4D12. Western Blot analysis of TLR5 expression in FHs 173 WE.)

Mouse TLR5 Monoclonal Antibody | anti-TLR5 antibody

TLR5 (Toll-like Receptor 5, FLJ10052, MGC126430, MGC126431, SLEB1, TIL3) (PE)

Gene Names
TLR5; SLE1; TIL3; SLEB1; MELIOS
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
TLR5; Monoclonal Antibody; TLR5 (Toll-like Receptor 5; FLJ10052; MGC126430; MGC126431; SLEB1; TIL3) (PE); Toll-like Receptor 5; TIL3; anti-TLR5 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4D12
Specificity
Recognizes TLR5.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-TLR5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TLR5 (NP_003259.2, 351aa-450aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LYSSNFYGLPKVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPKINLTANLIHLSENRLENLDILYFLLRVPHL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TLR5 monoclonal antibody (M10), clone 4D12. Western Blot analysis of TLR5 expression in FHs 173 WE.)

Western Blot (WB) (TLR5 monoclonal antibody (M10), clone 4D12. Western Blot analysis of TLR5 expression in FHs 173 WE.)
Related Product Information for anti-TLR5 antibody
The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene product is expressed in myelomonocytic cells, and recognizes bacterial flagellin, a principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB and stimulates tumour necrosis factor-alpha production. [provided by RefSeq]
Product Categories/Family for anti-TLR5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97,834 Da
NCBI Official Full Name
toll-like receptor 5
NCBI Official Synonym Full Names
toll like receptor 5
NCBI Official Symbol
TLR5
NCBI Official Synonym Symbols
SLE1; TIL3; SLEB1; MELIOS
NCBI Protein Information
toll-like receptor 5
UniProt Protein Name
Toll-like receptor 5
Protein Family
UniProt Gene Name
TLR5
UniProt Synonym Gene Names
TIL3
UniProt Entry Name
TLR5_HUMAN

NCBI Description

This gene encodes a member of the toll-like receptor (TLR) family, which plays a fundamental role in pathogen recognition and activation of innate immune responses. These receptors recognize distinct pathogen-associated molecular patterns that are expressed on infectious agents. The protein encoded by this gene recognizes bacterial flagellin, the principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB, which in turn activates a host of inflammatory-related target genes. Mutations in this gene have been associated with both resistance and susceptibility to systemic lupus erythematosus, and susceptibility to Legionnaire disease.[provided by RefSeq, Dec 2009]

Uniprot Description

TLR5: Participates in the innate immune response to microbial agents. Mediates detection of bacterial flagellins. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Genetic variation in TLR5 is associated with resistance to systemic lupus erythematosus type 1 (SLEB1). Systemic lupus erythematosus (SLE) is a chronic autoimmune disease with a complex genetic basis. SLE is an inflammatory, and often febrile multisystemic disorder of connective tissue characterized principally by involvement of the skin, joints, kidneys, and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Belongs to the Toll-like receptor family.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q41-q42

Cellular Component: integral to membrane; plasma membrane

Molecular Function: transmembrane receptor activity; interleukin-1 receptor binding

Biological Process: toll-like receptor 5 signaling pathway; positive regulation of interleukin-8 production; MyD88-dependent toll-like receptor signaling pathway; regulation of cytokine secretion; positive regulation of nitric oxide biosynthetic process; male gonad development; defense response to bacterium; toll-like receptor signaling pathway; innate immune response; inflammatory response; positive regulation of toll-like receptor signaling pathway; toll-like receptor 10 signaling pathway

Disease: Legionnaire Disease, Susceptibility To; Systemic Lupus Erythematosus, Susceptibility To, 1; Melioidosis, Susceptibility To

Research Articles on TLR5

Similar Products

Product Notes

The TLR5 tlr5 (Catalog #AAA6185493) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TLR5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TLR5 tlr5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TLR5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.