Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.9kD).)

Mouse TIMM9 Monoclonal Antibody | anti-TIMM9 antibody

TIMM9 (Mitochondrial Import Inner Membrane Translocase Subunit Tim9, TIM9, TIM9A, TIMM9A) (AP)

Gene Names
TIMM9; TIM9; TIM9A
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TIMM9; Monoclonal Antibody; TIMM9 (Mitochondrial Import Inner Membrane Translocase Subunit Tim9; TIM9; TIM9A; TIMM9A) (AP); anti-TIMM9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D6
Specificity
Recognizes human TIMM9. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TIMM9 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-90 from human TIMM9 (AAH20213) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.9kD).)

Western Blot (WB)

(TIMM9 monoclonal antibody. Western Blot analysis of TIMM9 expression in PC-12.)

Western Blot (WB) (TIMM9 monoclonal antibody. Western Blot analysis of TIMM9 expression in PC-12.)

Western Blot (WB)

(Western Blot analysis of TIMM9 expression in transfected 293T cell line by TIMM9 monoclonal antibody. Lane 1: TIMM9 transfected lysate (10.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TIMM9 expression in transfected 293T cell line by TIMM9 monoclonal antibody. Lane 1: TIMM9 transfected lysate (10.4kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TIMM9 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TIMM9 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TIMM9 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TIMM9 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(TIMM9 monoclonal antibody Western Blot analysis of TIMM9 expression in IMR-32.)

Western Blot (WB) (TIMM9 monoclonal antibody Western Blot analysis of TIMM9 expression in IMR-32.)

Western Blot (WB)

(TIMM9 monoclonal antibody. Western Blot analysis of TIMM9 expression in Raw 264.7.)

Western Blot (WB) (TIMM9 monoclonal antibody. Western Blot analysis of TIMM9 expression in Raw 264.7.)
Product Categories/Family for anti-TIMM9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
10,378 Da
NCBI Official Full Name
Homo sapiens translocase of inner mitochondrial membrane 9 homolog (yeast), mRNA
NCBI Official Synonym Full Names
translocase of inner mitochondrial membrane 9
NCBI Official Symbol
TIMM9
NCBI Official Synonym Symbols
TIM9; TIM9A
NCBI Protein Information
mitochondrial import inner membrane translocase subunit Tim9

NCBI Description

TIMM9 belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM, Apr 2004]

Research Articles on TIMM9

Similar Products

Product Notes

The TIMM9 (Catalog #AAA6134206) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TIMM9 (Mitochondrial Import Inner Membrane Translocase Subunit Tim9, TIM9, TIM9A, TIMM9A) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TIMM9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TIMM9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TIMM9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.