Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse TIE1 Monoclonal Antibody | anti-TIE1 antibody

TIE1 (Tyrosine Kinase with Immunoglobulin-like and EGF-like Domains 1, JTK14, TIE) (Biotin)

Gene Names
TIE1; TIE; JTK14
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
TIE1; Monoclonal Antibody; TIE1 (Tyrosine Kinase with Immunoglobulin-like and EGF-like Domains 1; JTK14; TIE) (Biotin); Tyrosine Kinase with Immunoglobulin-like and EGF-like Domains 1; TIE; anti-TIE1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3000
Specificity
Recognizes TIE1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-TIE1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TIE1 (NP_005415, 536aa-643aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSG*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-TIE1 antibody
Mouse monoclonal antibody raised against a full length recombinant TIE1.
Product Categories/Family for anti-TIE1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,138 Da
NCBI Official Full Name
tyrosine-protein kinase receptor Tie-1 isoform 1
NCBI Official Synonym Full Names
tyrosine kinase with immunoglobulin-like and EGF-like domains 1
NCBI Official Symbol
TIE1
NCBI Official Synonym Symbols
TIE; JTK14
NCBI Protein Information
tyrosine-protein kinase receptor Tie-1; tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1
UniProt Protein Name
Tyrosine-protein kinase receptor Tie-1
UniProt Gene Name
TIE1
UniProt Synonym Gene Names
TIE
UniProt Entry Name
TIE1_HUMAN

Uniprot Description

TIE1: Transmembrane tyrosine-protein kinase that may modulate TEK/TIE2 activity and contribute to the regulation of angiogenesis. Belongs to the protein kinase superfamily. Tyr protein kinase family. Tie subfamily.

Protein type: Kinase, protein; Protein kinase, TK; Membrane protein, integral; EC 2.7.10.1; Protein kinase, tyrosine (receptor); TK group; Tie family

Chromosomal Location of Human Ortholog: 1p34-p33

Cellular Component: integral to plasma membrane

Molecular Function: protein binding; transmembrane receptor protein tyrosine kinase activity; ATP binding

Biological Process: negative regulation of angiogenesis; peptidyl-tyrosine phosphorylation; response to retinoic acid; in utero embryonic development; mesoderm development; angiogenesis; signal transduction; vasculogenesis; negative regulation of cell migration; plasma membrane fusion

Similar Products

Product Notes

The TIE1 tie1 (Catalog #AAA6172185) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TIE1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TIE1 tie1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TIE1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.