Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse TIAF1 Monoclonal Antibody | anti-TIAF1 antibody

TIAF1 (TGFB1-Induced anti-Apoptotic Factor 1, MAJN, MYO18A, MYSPDZ, SPR210) (MaxLight 550)

Gene Names
TIAF1; MAJN; SPR210
Applications
Western Blot
Purity
Purified
Synonyms
TIAF1; Monoclonal Antibody; TIAF1 (TGFB1-Induced anti-Apoptotic Factor 1; MAJN; MYO18A; MYSPDZ; SPR210) (MaxLight 550); TGFB1-Induced anti-Apoptotic Factor 1; SPR210; anti-TIAF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B9
Specificity
Recognizes TIAF1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-TIAF1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TIAF1 (NP_004731.2, 1aa-115aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TIAF1 antibody
Mouse monoclonal antibody raised against a full-length recombinant TIAF1.
Product Categories/Family for anti-TIAF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,414 Da
NCBI Official Full Name
TGFB1-induced anti-apoptotic factor 1
NCBI Official Synonym Full Names
TGFB1-induced anti-apoptotic factor 1
NCBI Official Symbol
TIAF1
NCBI Official Synonym Symbols
MAJN; SPR210
NCBI Protein Information
TGFB1-induced anti-apoptotic factor 1; 12 kDa TGF-beta-1-induced antiapoptotic factor; TGF-beta-1-induced antiapoptotic factor 1; molecule associated with Jak-3 N-terminal
UniProt Protein Name
TGFB1-induced anti-apoptotic factor 1
UniProt Gene Name
TIAF1
UniProt Entry Name
TIAF1_HUMAN

Uniprot Description

TIAF1: Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: nucleus

Biological Process: I-kappaB kinase/NF-kappaB cascade; apoptosis; negative regulation of apoptosis

Research Articles on TIAF1

Similar Products

Product Notes

The TIAF1 tiaf1 (Catalog #AAA6219660) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TIAF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TIAF1 tiaf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TIAF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.