Mouse anti-Human THRSP Monoclonal Antibody | anti-THRSP antibody

THRSP (Thyroid Hormone-inducible Hepatic Protein, Spot 14 Protein, S14, MGC21659, S14, SPOT14) (Biotin)

Cat. Num. AAA6144802

• Gene Names: THRSP; S14; Lpgp; THRP; LPGP1; SPOT14
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: THRSP; Monoclonal Antibody; THRSP (Thyroid Hormone-inducible Hepatic Protein; Spot 14 Protein; S14; MGC21659; SPOT14) (Biotin); anti-THRSP antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2F8
• Specificity: Recognizes human THRSP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-THRSP antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-85 from human THRSP (NP_003242) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKV
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to THRSP on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged THRSP is 0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-THRSP antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4507497
• NCBI GeneID: 7069
• NCBI Accession #: NP_003242
• NCBI GenBank Nucleotide #: NM_003251
• UniProt Accession #: Q92748; B2R4W7
• Molecular Weight: 18.9kDa (169aa), confirmed by MALDI-TOF
• NCBI Official Full Name: thyroid hormone-inducible hepatic protein
• NCBI Official Synonym Full Names: thyroid hormone responsive
• NCBI Official Symbol: THRSP
• NCBI Official Synonym Symbols: S14; Lpgp; THRP; LPGP1; SPOT14
• NCBI Protein Information: thyroid hormone-inducible hepatic protein
• UniProt Protein Name: Thyroid hormone-inducible hepatic protein
• Protein Family: Thyroid hormone-inducible hepatic protein
• UniProt Gene Name: THRSP
• UniProt Synonym Gene Names: S14; SPOT14
• UniProt Entry Name: THRSP_HUMAN

NCBI Description

The protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism. [provided by RefSeq, Jul 2008]

Uniprot Description

THRSP: Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA. May function as transcriptional coactivator. May modulate the transcription factor activity of THRB. Belongs to the SPOT14 family.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 11q14.1

Cellular Component: nucleoplasm; cytosol

Molecular Function: protein homodimerization activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; lipid metabolic process; regulation of lipid biosynthetic process