Mouse anti-Human THOC3 Monoclonal Antibody | anti-THOC3 antibody

THOC3 (THO Complex Subunit 3, Tho3, TEX1 Homolog, hTREX45) (Biotin)

Cat. Num. AAA6144800

• Gene Names: THOC3; THO3; hTREX45
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: THOC3; Monoclonal Antibody; THOC3 (THO Complex Subunit 3; Tho3; TEX1 Homolog; hTREX45) (Biotin); anti-THOC3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 3D4
• Specificity: Recognizes human THOC3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-THOC3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: ELISA: 1ng/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa252-352 from human THOC3 (NP_115737) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DVDELVCVRCFSRLDWPVRTLSFSHDGKMLASASEDHFIDIAEVETGDKLWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPNDS
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of THOC3 expression in transfected 293T cell line by THOC3 monoclonal antibody. Lane 1: THOC3 transfected lysate (38.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged THOC3 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-THOC3 antibody

Antibodies; RNA Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 14150171
• NCBI GeneID: 84321
• NCBI Accession #: NP_115737.1
• NCBI GenBank Nucleotide #: NM_032361
• UniProt Accession #: Q96J01
• Molecular Weight: 38,772 Da
• NCBI Official Full Name: THO complex subunit 3
• NCBI Official Synonym Full Names: THO complex 3
• NCBI Official Symbol: THOC3
• NCBI Official Synonym Symbols: THO3; hTREX45
• NCBI Protein Information: THO complex subunit 3; TEX1 homolog
• UniProt Protein Name: THO complex subunit 3
• UniProt Gene Name: THOC3
• UniProt Synonym Gene Names: Tho3
• UniProt Entry Name: THOC3_HUMAN

NCBI Description

This gene encodes a component of the nuclear THO transcription elongation complex, which is part of the larger transcription export (TREX) complex that couples messenger RNA processing and export. In humans, the transcription export complex is recruited to the 5'-end of messenger RNAs in a splicing- and cap-dependent manner. Studies of a related complex in mouse suggest that the metazoan transcription export complex is involved in cell differentiation and development. A pseudogene of this gene has been defined on chromosome 5. [provided by RefSeq, May 2013]

Uniprot Description

Function: Component of the THO subcomplex of the TREX complex. The TREX complex specifically associates with spliced mRNA and not with unspliced pre-mRNA. It is recruited to spliced mRNAs by a transcription-independent mechanism. Binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export. The recruitment occurs via an interaction between ALYREF/THOC4 and the cap-binding protein NCBP1. DDX39B functions as a bridge between ALYREF/THOC4 and the THO complex. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. The recruitment of the TREX complex to the intronless viral mRNA occurs via an interaction between KSHV ORF57 protein and ALYREF/THOC4. Ref.3 Ref.4 Ref.5 Ref.6 Ref.7

Subunit structure: Component of the THO complex, which is composed of THOC1, THOC2, THOC5, THOC6 and THOC7. Together with THOC3, ALYREF/THOC4 and DDX39B, THO forms the transcription/export (TREX) complex. Ref.4 Ref.5

Subcellular location: Nucleus

Probable.

Sequence similarities: Contains 6 WD repeats.

Caution: There are two almost identical copies of this gene on chromosome 5q35. One copy is frameshifted and unlikely to encode a functional protein.