Mouse anti-Human TFCP2 Monoclonal Antibody | anti-TFCP2 antibody

TFCP2 (Alpha-globin Transcription Factor CP2, SAA3 Enhancer Factor, Transcription Factor LSF, LSF, SEF) (FITC)

Cat. Num. AAA6150085

• Gene Names: TFCP2; LSF; SEF; LBP1C; LSF1D; TFCP2C
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TFCP2; Monoclonal Antibody; TFCP2 (Alpha-globin Transcription Factor CP2; SAA3 Enhancer Factor; Transcription Factor LSF; LSF; SEF) (FITC); anti-TFCP2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a, lambda
• Clone Number: 3H6
• Specificity: Recognizes human TFCP2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-TFCP2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa414-503 from human TFCP2 (AAH03634) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KHEDGDSNGTFFVYHAIYLEELTAVELTEKIAQLFSISPCQISQIYKQGPTGIHVLISDEMIQNFQEEACFILDTMKAETNDSYHIILK
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TFCP2 expression in transfected 293T cell line by TFCP2 monoclonal antibody. Lane 1: TFCP2 transfected lysate (57.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TFCP2 is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-TFCP2 antibody

Transcription factor LSF (late simian virus 40 factor) also known as transcription factor LSF, CP2, LBP-1c, and SEF is expressed in a variety of cell types including brain, ovary, kidney, thymus, spleen, liver, adrenal, heart and lung. LSF is essential for cell cycle progression at the G1/S transition after reentry into the cell cycle from G0. LSF plays an important role in DNA synthesis and cell survival. A major cellular target of LSF is the thymidylate synthase (TS) gene coding for the rate limiting enzyme in the production of dTTP. Disruption of LSF function results in apoptosis at S phase or to cell cycle arrest at the G1/S transition.

Product Categories/Family for anti-TFCP2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 33872685
• NCBI GeneID: 7024
• Molecular Weight: 57,185 Da
• NCBI Official Full Name: Homo sapiens transcription factor CP2, mRNA
• NCBI Official Synonym Full Names: transcription factor CP2
• NCBI Official Symbol: TFCP2
• NCBI Official Synonym Symbols: LSF; SEF; LBP1C; LSF1D; TFCP2C
• NCBI Protein Information: alpha-globin transcription factor CP2
• Protein Family: Transcription factor

NCBI Description

This gene encodes a transcription factor that binds the alpha-globin promoter and activates transcription of the alpha-globin gene. The encoded protein regulates erythroid gene expression, plays a role in the transcriptional switch of globin gene promoters, and it activates many other cellular and viral gene promoters. The gene product interacts with certain inflammatory response factors, and polymorphisms of this gene may be involved in the pathogenesis of Alzheimer's disease. [provided by RefSeq, Mar 2010]