Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human TFAP2C Monoclonal Antibody | anti-TFAP2C antibody

TFAP2C (Transcription Factor AP-2 gamma, AP2-gamma, Activating Enhancer-binding Protein 2 gamma, Transcription Factor ERF-1)

Gene Names
TFAP2C; ERF1; TFAP2G; hAP-2g; AP2-GAMMA
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TFAP2C; Monoclonal Antibody; TFAP2C (Transcription Factor AP-2 gamma; AP2-gamma; Activating Enhancer-binding Protein 2 gamma; Transcription Factor ERF-1); Anti -TFAP2C (Transcription Factor AP-2 gamma; anti-TFAP2C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C8
Specificity
Recognizes human TFAP2C.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
GRNEMAARKNMLLAAQQLCKEFTELLSQDRTPHGTSRLAPVLETNIQNCLSHFSLITHGFGSQAICAAVSALQNYIKEALIVIDKSYMNPGDQSPADSNKTLEKMEKHRK
Applicable Applications for anti-TFAP2C antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa341-451 from human TFAP2C (NP_003213) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-TFAP2C antibody
Transcription factor gene AP2-C (AP-2 gamma) belongs to a family of four closely related genes. The AP-2 transcription factor has been shown to play an important role in the development of tissues of ectodermal origin and has also been implicated in mammary oncogenesis. A physical and functional association between AP-2gamma transcription factor and the Wwox protein has been demonstrated. results suggest that Wwox tumor suppressor protein inhibits AP-2gamma oncogenic activity by sequestering it in the cytoplasm. P-2 gamma had been implicated in multiple functions during proliferation and differentiation based on its expression pattern in trophoblast, neural crest, and ectoderm cells in murine embryos. AP-2 gamma seems to be required in early embryonic development because it regulates the genetic programs controlling proliferation and differentiation of extraembryonic trophectodermal cells.
Product Categories/Family for anti-TFAP2C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,177 Da
NCBI Official Full Name
transcription factor AP-2 gamma
NCBI Official Synonym Full Names
transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma)
NCBI Official Symbol
TFAP2C
NCBI Official Synonym Symbols
ERF1; TFAP2G; hAP-2g; AP2-GAMMA
NCBI Protein Information
transcription factor AP-2 gamma; estrogen receptor factor 1; transcription factor ERF-1; activating enhancer-binding protein 2 gamma; transcription factor AP-2 gamma (activating enhancer-binding protein 2 gamma)
UniProt Protein Name
Transcription factor AP-2 gamma
Protein Family
UniProt Gene Name
TFAP2C
UniProt Synonym Gene Names
AP2-gamma
UniProt Entry Name
AP2C_HUMAN

NCBI Description

The protein encoded by this gene is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The encoded protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube. [provided by RefSeq, Jul 2008]

Uniprot Description

AP-2 gamma: Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. Binds DNA as a dimer. Can form homodimers or heterodimers with other AP-2 family members. Interacts with WWOX. Interacts with CITED4. Interacts with UBE2I. Interacts with KCTD1; this interaction represses transcription activation. Interacts with CITED2 (via C-terminus); the interaction stimulates TFAP2B-transcriptional activity. During retinoic acid-mediated differentiation. Belongs to the AP-2 family.

Protein type: Transcription factor; Motility/polarity/chemotaxis; DNA-binding

Chromosomal Location of Human Ortholog: 20q13.2

Cellular Component: nucleus

Molecular Function: protein dimerization activity; protein binding; DNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; somatic stem cell maintenance; male gonad development; sebaceous gland development; germ-line stem cell maintenance; negative regulation of transcription from RNA polymerase II promoter; regulation of gene expression, epigenetic; regulation of cell proliferation; trophectodermal cell differentiation; regulation of transcription from RNA polymerase II promoter; hair follicle development; cell-cell signaling; positive regulation of transcription from RNA polymerase II promoter; cerebral cortex development; forebrain neuron fate commitment; regulation of epidermis development

Research Articles on TFAP2C

Similar Products

Product Notes

The TFAP2C tfap2c (Catalog #AAA642651) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TFAP2C (Transcription Factor AP-2 gamma, AP2-gamma, Activating Enhancer-binding Protein 2 gamma, Transcription Factor ERF-1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TFAP2C can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the TFAP2C tfap2c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GRNEMAARKN MLLAAQQLCK EFTELLSQDR TPHGTSRLAP VLETNIQNCL SHFSLITHGF GSQAICAAVS ALQNYIKEAL IVIDKSYMNP GDQSPADSNK TLEKMEKHRK. It is sometimes possible for the material contained within the vial of "TFAP2C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.