Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TFAP2B expression in transfected 293T cell line by TFAP2B monoclonal antibody (M02), clone 2F6.Lane 1: TFAP2B transfected lysate (50.474 KDa).Lane 2: Non-transfected lysate.)

Mouse TFAP2B Monoclonal Antibody | anti-TFAP2B antibody

TFAP2B (Transcription Factor AP-2 beta (Activating Enhancer Binding Protein 2 beta), AP-2B, AP2-B, MGC21381) (HRP)

Gene Names
TFAP2B; PDA2; AP-2B; AP2-B
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
TFAP2B; Monoclonal Antibody; TFAP2B (Transcription Factor AP-2 beta (Activating Enhancer Binding Protein 2 beta); AP-2B; AP2-B; MGC21381) (HRP); Transcription Factor AP-2 beta (Activating Enhancer Binding Protein 2 beta); MGC21381; anti-TFAP2B antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F6
Specificity
Recognizes TFAP2B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-TFAP2B antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TFAP2B (NP_003212, 73aa-182aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TFAP2B expression in transfected 293T cell line by TFAP2B monoclonal antibody (M02), clone 2F6.Lane 1: TFAP2B transfected lysate (50.474 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TFAP2B expression in transfected 293T cell line by TFAP2B monoclonal antibody (M02), clone 2F6.Lane 1: TFAP2B transfected lysate (50.474 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TFAP2B on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TFAP2B on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TFAP2B on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TFAP2B on HeLa cell. [antibody concentration 10 ug/ml])
Product Categories/Family for anti-TFAP2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
transcription factor AP-2-beta
NCBI Official Synonym Full Names
transcription factor AP-2 beta
NCBI Official Symbol
TFAP2B
NCBI Official Synonym Symbols
PDA2; AP-2B; AP2-B
NCBI Protein Information
transcription factor AP-2-beta
UniProt Protein Name
Transcription factor AP-2-beta
Protein Family
UniProt Gene Name
TFAP2B
UniProt Entry Name
AP2B_HUMAN

NCBI Description

This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives. [provided by RefSeq, Jul 2008]

Research Articles on TFAP2B

Similar Products

Product Notes

The TFAP2B tfap2b (Catalog #AAA6180613) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TFAP2B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TFAP2B tfap2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TFAP2B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.