Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.14kD) using 128003.)

Mouse anti-Human HOPX Monoclonal Antibody | anti-HOPX antibody

HOPX (Homeodomain-only Protein, Lung Cancer-associated Y Protein, Not Expressed in Choriocarcinoma Protein 1, Odd Homeobox Protein 1, HOPX, HOD, HOP, LAGY, NECC1, OB1, MGC20820) (PE)

Gene Names
HOPX; HOD; HOP; OB1; LAGY; TOTO; CAMEO; NECC1; SMAP31
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HOPX; Monoclonal Antibody; HOPX (Homeodomain-only Protein; Lung Cancer-associated Y Protein; Not Expressed in Choriocarcinoma Protein 1; Odd Homeobox Protein 1; HOD; HOP; LAGY; NECC1; OB1; MGC20820) (PE); anti-HOPX antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D6
Specificity
Recognizes human HOP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-HOPX antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-73 from human HOP (AAH14225) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.14kD) using 128003.)

Western Blot (WB) (Western Blot detection against Immunogen (34.14kD) using 128003.)

Testing Data

(Detection limit for recombinant GST tagged HOP is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HOP is ~3ng/ml as a capture antibody.)
Related Product Information for anti-HOPX antibody
Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy. May act as a tumor suppressor.
Product Categories/Family for anti-HOPX antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
12,625 Da
NCBI Official Full Name
Homo sapiens HOP homeobox, mRNA
NCBI Official Synonym Full Names
HOP homeobox
NCBI Official Symbol
HOPX
NCBI Official Synonym Symbols
HOD; HOP; OB1; LAGY; TOTO; CAMEO; NECC1; SMAP31
NCBI Protein Information
homeodomain-only protein
Protein Family

NCBI Description

The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggest that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Feb 2009]

Research Articles on HOPX

Similar Products

Product Notes

The HOPX (Catalog #AAA6158230) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HOPX (Homeodomain-only Protein, Lung Cancer-associated Y Protein, Not Expressed in Choriocarcinoma Protein 1, Odd Homeobox Protein 1, HOPX, HOD, HOP, LAGY, NECC1, OB1, MGC20820) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HOPX can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOPX for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOPX, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.