Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human Tetratricopeptide Repeat Protein 1 Monoclonal Antibody | anti-TPR1 antibody

Tetratricopeptide Repeat Protein 1 (TPR Repeat Protein 1, TTC1, TPR1) (FITC)

Gene Names
TTC1; TPR1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Tetratricopeptide Repeat Protein 1; Monoclonal Antibody; Tetratricopeptide Repeat Protein 1 (TPR Repeat Protein 1; TTC1; TPR1) (FITC); anti-TPR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4E3
Specificity
Recognizes human TTC1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-TPR1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa193-292 from human TTC1 (NP_003305) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LRRAELYEKTDKLDEALEDYKSILEKDPSIHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSYSINFVQNPNNNR
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TTC1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 1.5ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TTC1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 1.5ug/ml])
Product Categories/Family for anti-TPR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,526 Da
NCBI Official Full Name
tetratricopeptide repeat protein 1
NCBI Official Synonym Full Names
tetratricopeptide repeat domain 1
NCBI Official Symbol
TTC1
NCBI Official Synonym Symbols
TPR1
NCBI Protein Information
tetratricopeptide repeat protein 1; TPR repeat protein 1
UniProt Protein Name
Tetratricopeptide repeat protein 1
Protein Family
UniProt Gene Name
TTC1
UniProt Synonym Gene Names
TPR1; TPR repeat protein 1
UniProt Entry Name
TTC1_HUMAN

NCBI Description

This gene encodes a protein that belongs to the tetratrico peptide repeat superfamily of proteins. The encoded protein plays a role in protein-protein interactions, and binds to the Galpha subunit of G protein-coupled receptors to activate the Ras signaling pathway. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]

Uniprot Description

TTC1: Interacts with the GAP domain of NF1.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 5q33.3

Cellular Component: peroxisomal membrane; cytoplasm

Molecular Function: protein binding; unfolded protein binding

Biological Process: protein folding

Research Articles on TPR1

Similar Products

Product Notes

The TPR1 ttc1 (Catalog #AAA6150272) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Tetratricopeptide Repeat Protein 1 (TPR Repeat Protein 1, TTC1, TPR1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Tetratricopeptide Repeat Protein 1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TPR1 ttc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Tetratricopeptide Repeat Protein 1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.