Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TEK monoclonal antibody (M18), clone 4G10 Western Blot analysis of TEK expression in PC-12 (Cat # L012V1).)

Mouse TEK Monoclonal Antibody | anti-TEK antibody

TEK (TEK Tyrosine Kinase, Endothelial, CD202B, TIE-2, TIE2, VMCM, VMCM1) (HRP)

Gene Names
TEK; TIE2; VMCM; GLC3E; TIE-2; VMCM1; CD202B
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
TEK; Monoclonal Antibody; TEK (TEK Tyrosine Kinase; Endothelial; CD202B; TIE-2; TIE2; VMCM; VMCM1) (HRP); TEK Tyrosine Kinase; VMCM1; anti-TEK antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G10
Specificity
Recognizes TEK.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-TEK antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TEK (NP_000450, 66aa-185aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQD*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TEK monoclonal antibody (M18), clone 4G10 Western Blot analysis of TEK expression in PC-12 (Cat # L012V1).)

Western Blot (WB) (TEK monoclonal antibody (M18), clone 4G10 Western Blot analysis of TEK expression in PC-12 (Cat # L012V1).)
Product Categories/Family for anti-TEK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107.9kDa (965aa) 100-150KDa (SDS-PAGE under reducing conditions.)
NCBI Official Full Name
angiopoietin-1 receptor isoform 1
NCBI Official Synonym Full Names
TEK receptor tyrosine kinase
NCBI Official Symbol
TEK
NCBI Official Synonym Symbols
TIE2; VMCM; GLC3E; TIE-2; VMCM1; CD202B
NCBI Protein Information
angiopoietin-1 receptor
UniProt Protein Name
Angiopoietin-1 receptor
Protein Family
UniProt Gene Name
TEK
UniProt Synonym Gene Names
TIE2; VMCM; VMCM1; hTIE2
UniProt Entry Name
TIE2_HUMAN

NCBI Description

This gene encodes a receptor that belongs to the protein tyrosine kinase Tie2 family. The encoded protein possesses a unique extracellular region that contains two immunoglobulin-like domains, three epidermal growth factor (EGF)-like domains and three fibronectin type III repeats. The ligand angiopoietin-1 binds to this receptor and mediates a signaling pathway that functions in embryonic vascular development. Mutations in this gene are associated with inherited venous malformations of the skin and mucous membranes. Alternative splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Feb 2014]

Uniprot Description

TIE2: a receptor tyrosine kinase of the Tie family. Receptor for angiopoietin 1. Expressed almost exclusively in endothelial cells. May constitute the earliest mammalian endothelial cell lineage marker. Appears to be critical for endothelial cell-smooth muscle cell communication in venous morphogenesis. TEK is closely related to the TIE receptor tyrosine kinase.

Protein type: Membrane protein, integral; EC 2.7.10.1; Kinase, protein; Protein kinase, TK; Protein kinase, tyrosine (receptor); TK group; Tie family

Chromosomal Location of Human Ortholog: 9p21

Cellular Component: microvillus; cell surface; focal adhesion; basolateral plasma membrane; integral to plasma membrane; extracellular region; actin filament; intercellular junction; lipid raft; perinuclear region of cytoplasm; apical plasma membrane; plasma membrane; stress fiber; basal plasma membrane

Molecular Function: protein binding; growth factor binding; protein-tyrosine kinase activity; receptor activity; transmembrane receptor protein tyrosine kinase activity; ATP binding; protein kinase activity

Biological Process: response to peptide hormone stimulus; peptidyl-tyrosine phosphorylation; response to cAMP; cell-matrix adhesion; heart development; protein amino acid autophosphorylation; positive regulation of cytokine secretion during immune response; signal transduction; cell-cell adhesion; cell-cell signaling; positive regulation of focal adhesion formation; angiogenesis; endochondral ossification; Tie receptor signaling pathway; organ regeneration; regulation of establishment and/or maintenance of cell polarity; positive regulation of phosphoinositide 3-kinase activity; positive regulation of peptidyl-serine phosphorylation; protein oligomerization; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of protein kinase B signaling cascade; negative regulation of angiogenesis; positive regulation of angiogenesis; positive regulation of protein import into nucleus; response to estrogen stimulus; negative regulation of inflammatory response; endothelial cell proliferation; response to hypoxia; positive regulation of endothelial cell proliferation; regulation of vascular permeability; sprouting angiogenesis; positive regulation of protein amino acid phosphorylation; blood coagulation; leukocyte migration; transmembrane receptor protein tyrosine kinase signaling pathway; negative regulation of apoptosis

Disease: Venous Malformations, Multiple Cutaneous And Mucosal

Research Articles on TEK

Similar Products

Product Notes

The TEK tek (Catalog #AAA6180222) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TEK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TEK tek for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TEK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.