Mouse anti-Human TDP1 Monoclonal Antibody | anti-TDP1 antibody

TDP1 (Tyrosyl-DNA Phosphodiesterase 1, Tyr-DNA Phosphodiesterase 1) APC

Cat. Num. AAA6139459

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TDP1; Monoclonal Antibody; TDP1 (Tyrosyl-DNA Phosphodiesterase 1; Tyr-DNA Phosphodiesterase 1) APC; EC=3.1.4.-; FLJ11090; MGC104252; anti-TDP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A10-G2
• Specificity: Recognizes human TDP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 2344

• Applicable Applications for anti-TDP1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: ELISA: 0.1ng/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-609 from human TDP1 (AAH15474) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHADWHQKTQGIWLSPLYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSETNVYLIGSTPGRFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSSVGSLGADESKWLCSEFKESMLTLGKESKTPGKSSVPLYLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQNWLHSYFHKWSAETSGRSNAMPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGLDSFKVKQKFFAGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDTHGNMWVPS
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (92.99kD).)

Testing Data

(Detection limit for recombinant GST tagged TDP1 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-TDP1 antibody

Antibodies; Enzymes; Phosphodiesterase

NCBI and Uniprot Product Information

• NCBI GI #: 15930061
• NCBI GeneID: 55775
• NCBI Official Full Name: Homo sapiens tyrosyl-DNA phosphodiesterase 1, mRNA
• NCBI Official Synonym Full Names: tyrosyl-DNA phosphodiesterase 1
• NCBI Official Symbol: TDP1
• NCBI Protein Information: tyrosyl-DNA phosphodiesterase 1
• Protein Family: Tyrosyl-DNA phosphodiesterase

NCBI Description

The protein encoded by this gene is involved in repairing stalled topoisomerase I-DNA complexes by catalyzing the hydrolysis of the phosphodiester bond between the tyrosine residue of topoisomerase I and the 3-prime phosphate of DNA. This protein may also remove glycolate from single-stranded DNA containing 3-prime phosphoglycolate, suggesting a role in repair of free-radical mediated DNA double-strand breaks. This gene is a member of the phospholipase D family and contains two PLD phosphodiesterase domains. Mutations in this gene are associated with the disease spinocerebellar ataxia with axonal neuropathy (SCAN1). [provided by RefSeq, Aug 2016]