Mouse anti-Human TCIRG1 Monoclonal Antibody | anti-TCIRG1 antibody

TCIRG1 (T-cell Immune Regulator 1, ATP6N1C, ATP6V0A3, V-type Proton ATPase 116kD Subunit a Isoform 3, V-ATPase 116kD Isoform a3, Osteoclastic Proton Pump 116kD Subunit, OC-116kD, OC116, T-cell Immune Response cDNA7 Protein, TIRC7, Vacuolar Proton Transloc

Cat. Num. AAA6155362

• Gene Names: TCIRG1; a3; Stv1; Vph1; Atp6i; OC116; OPTB1; TIRC7; ATP6N1C; ATP6V0A3; OC-116kDa
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TCIRG1; Monoclonal Antibody; TCIRG1 (T-cell Immune Regulator 1; ATP6N1C; ATP6V0A3; V-type Proton ATPase 116kD Subunit a Isoform 3; V-ATPase 116kD Isoform a3; Osteoclastic Proton Pump 116kD Subunit; OC-116kD; OC116; T-cell Immune Response cDNA7 Protein; TIRC7; Vacuolar Proton Transloc; a3; Atp6i; OPTB1; Stv1; Vph1; anti-TCIRG1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6H3
• Specificity: Recognizes human TCIRG1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-TCIRG1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa121-220 from TCIRG1 (AAH18133) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Product Categories/Family for anti-TCIRG1 antibody

Antibodies; Enzymes; ATPase

References

1. A specific subtype of osteoclasts secretes factors inducing nodule formation by osteoblasts. Henriksen K, Andreassen KV, Thudium CS, Gudmann KN, Moscatelli I, Cruger-Hansen CE, Schulz AS, Dziegiel MH, Richter J, Karsdal MA, Neutzsky-Wulff AV.Bone. 2012 Jun 19;51(3):353-361. 2. Impaired gastric acidification negatively affects calcium homeostasis and bone mass. Schinke T, Schilling AF, Baranowsky A, Seitz S, Marshall RP, Linn T, Blaeker M, Huebner AK, Schulz A, Simon R, Gebauer M, Priemel M, Kornak U, Perkovic S, Barvencik F, Beil FT, Del Fattore A, Frattini A, Streichert T, Pueschel K, Villa A, Debatin KM, RuegNat Med. 2009 Jun;15(6):674-81. 3. Differential Localization of Vacuolar H+-ATPases Containing a1, a2, a3, or a4 (ATP6V0A1-4) Subunit Isoforms Along the Nephron. Schulz N, Dave MH, Stehberger PA, Chau T, Wagner CA.Cell Physiol Biochem. 2007;20(1-4):109-20.

NCBI and Uniprot Product Information

• NCBI GI #: 17390297
• NCBI GeneID: 10312
• Molecular Weight: 68,776 Da
• NCBI Official Full Name: Homo sapiens T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3, mRNA
• NCBI Official Synonym Full Names: T-cell immune regulator 1, ATPase H+ transporting V0 subunit a3
• NCBI Official Symbol: TCIRG1
• NCBI Official Synonym Symbols: a3; Stv1; Vph1; Atp6i; OC116; OPTB1; TIRC7; ATP6N1C; ATP6V0A3; OC-116kDa
• NCBI Protein Information: V-type proton ATPase 116 kDa subunit a isoform 3
• Protein Family: V-type proton ATPase

NCBI Description

Through alternate splicing, this gene encodes two proteins with similarity to subunits of the vacuolar ATPase (V-ATPase) but the encoded proteins seem to have different functions. V-ATPase is a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. V-ATPase is comprised of a cytosolic V1 domain and a transmembrane V0 domain. Mutations in this gene are associated with infantile malignant osteopetrosis. [provided by RefSeq, Jul 2008]