Mouse anti-Human TCF7 Monoclonal Antibody | anti-TCF7 antibody

TCF7 (Transcription Factor 7, T-cell Specific Transcription Factor 1, T-cell Factor 1, TCF-7, TCF-1, TCF1, MGC129647, MGC129648) (Biotin)

Cat. Num. AAA6144753

• Gene Names: TCF7; TCF-1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TCF7; Monoclonal Antibody; TCF7 (Transcription Factor 7; T-cell Specific Transcription Factor 1; T-cell Factor 1; TCF-7; TCF-1; TCF1; MGC129647; MGC129648) (Biotin); anti-TCF7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D2
• Specificity: Recognizes human TCF7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-TCF7 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa287-385 from human TCF7 (NP_003193) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TCF7 expression in transfected 293T cell line by TCF7 monoclonal antibody. Lane 1: TCF7 transfected lysate (41.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TCF7 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TCF7 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TCF7 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-TCF7 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 42518080
• NCBI GeneID: 6932
• NCBI Accession #: NP_003193
• NCBI GenBank Nucleotide #: NM_003202
• UniProt Accession #: Q86WR9; P36402
• Molecular Weight: 42kDa
• NCBI Official Full Name: transcription factor 7 isoform 1
• NCBI Official Synonym Full Names: transcription factor 7
• NCBI Official Symbol: TCF7
• NCBI Official Synonym Symbols: TCF-1
• NCBI Protein Information: transcription factor 7
• Protein Family: Transcription factor

NCBI Description

This gene encodes a member of the T-cell factor/lymphoid enhancer-binding factor family of high mobility group (HMG) box transcriptional activators. This gene is expressed predominantly in T-cells and plays a critical role in natural killer cell and innate lymphoid cell development. The encoded protein forms a complex with beta-catenin and activates transcription through a Wnt/beta-catenin signaling pathway. Mice with a knockout of this gene are viable and fertile, but display a block in T-lymphocyte differentiation. Alternative splicing results in multiple transcript variants. Naturally-occurring isoforms lacking the N-terminal beta-catenin interaction domain may act as dominant negative regulators of Wnt signaling. [provided by RefSeq, Oct 2016]