Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TCF19 monoclonal antibody Western Blot analysis of TCF19 expression in Hela NE.)

Mouse anti-Human TCF19 Monoclonal Antibody | anti-TCF19 antibody

TCF19 (Transcription Factor 19, TCF-19, SC1, SC1-1, Transcription Factor SC1) (FITC)

Gene Names
TCF19; SC1; TCF-19
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TCF19; Monoclonal Antibody; TCF19 (Transcription Factor 19; TCF-19; SC1; SC1-1; Transcription Factor SC1) (FITC); anti-TCF19 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6D8
Specificity
Recognizes human TCF19.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-TCF19 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa17-103 from human TCF19 (NP_009040) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DLYTFHPPAGVGCTYRLGHRADLCDVALRPQQEPGLISGIHAELHAEPRGDDWRVSLEDHSSQGTLVNNVRLPRGHRLELSDGDLL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TCF19 monoclonal antibody Western Blot analysis of TCF19 expression in Hela NE.)

Western Blot (WB) (TCF19 monoclonal antibody Western Blot analysis of TCF19 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of TCF19 expression in transfected 293T cell line by TCF19 monoclonal antibody. Lane 1: TCF19 transfected lysate (37.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TCF19 expression in transfected 293T cell line by TCF19 monoclonal antibody. Lane 1: TCF19 transfected lysate (37.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TCF19 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to TCF19 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TCF19 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TCF19 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TCF19 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TCF19 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of TCF19 over-expressed 293 cell line, cotransfected with TCF19 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF19 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of TCF19 over-expressed 293 cell line, cotransfected with TCF19 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TCF19 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-TCF19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
transcription factor 19
NCBI Official Synonym Full Names
transcription factor 19
NCBI Official Symbol
TCF19
NCBI Official Synonym Symbols
SC1; TCF-19
NCBI Protein Information
transcription factor 19
UniProt Protein Name
Transcription factor 19
Protein Family
UniProt Gene Name
TCF19
UniProt Synonym Gene Names
SC1; TCF-19
UniProt Entry Name
TCF19_HUMAN

NCBI Description

This gene encodes a protein that contains a PHD-type zinc finger domain and likely functions as a transcription factor. The encoded protein plays a role proliferation and apoptosis of pancreatic beta cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Uniprot Description

TCF19: Potential trans-activating factor that could play an important role in the transcription of genes required for the later stages of cell cycle progression.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: nucleus

Molecular Function: zinc ion binding; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; cell proliferation; transcription, DNA-dependent

Research Articles on TCF19

Similar Products

Product Notes

The TCF19 tcf19 (Catalog #AAA6150052) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TCF19 (Transcription Factor 19, TCF-19, SC1, SC1-1, Transcription Factor SC1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TCF19 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TCF19 tcf19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TCF19, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.