Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TCEB3 monoclonal antibody, Western Blot analysis of TCEB3 expression in Hela NE.)

Mouse anti-Human TCEB3 Monoclonal Antibody | anti-TCEB3 antibody

TCEB3 (Transcription Elongation Factor B Polypeptide 3, Elongin 110kD Subunit, Elongin-A, RNA Polymerase II Transcription Factor SIII Subunit A1, SIII p110, FLJ38760, FLJ42849) (AP)

Gene Names
TCEB3; EloA; SIII; TCEB3A; SIII p110
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TCEB3; Monoclonal Antibody; TCEB3 (Transcription Elongation Factor B Polypeptide 3; Elongin 110kD Subunit; Elongin-A; RNA Polymerase II Transcription Factor SIII Subunit A1; SIII p110; FLJ38760; FLJ42849) (AP); anti-TCEB3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F3
Specificity
Recognizes human TCEB3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TCEB3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa81-191 from human TCEB3 (NP_003189) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NAEPDEQDFEKSNSRKRPRDALQKEEEMEGDYQETWKATGSRSYSPDHRQKKHRKLSELERPHKVSHGHERRDERKRCHRMSPTYSSDPESSDYGHVQSPPSCTSPHQMY
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TCEB3 monoclonal antibody, Western Blot analysis of TCEB3 expression in Hela NE.)

Western Blot (WB) (TCEB3 monoclonal antibody, Western Blot analysis of TCEB3 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of TCEB3 expression in transfected 293T cell line by TCEB3 monoclonal antibody Lane 1: TCEB3 transfected lysate (87.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TCEB3 expression in transfected 293T cell line by TCEB3 monoclonal antibody Lane 1: TCEB3 transfected lysate (87.2kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TCEB3 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TCEB3 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-TCEB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89,909 Da
NCBI Official Full Name
transcription elongation factor B polypeptide 3
NCBI Official Synonym Full Names
transcription elongation factor B (SIII), polypeptide 3 (110kDa, elongin A)
NCBI Official Symbol
TCEB3
NCBI Official Synonym Symbols
EloA; SIII; TCEB3A; SIII p110
NCBI Protein Information
transcription elongation factor B polypeptide 3; RNA polymerase II transcription factor SIII subunit A1; elongin 110 kDa subunit; elongin-A; transcription elongation factor B alpha subunit
UniProt Protein Name
Transcription elongation factor B polypeptide 3
UniProt Gene Name
TCEB3
UniProt Synonym Gene Names
EloA
UniProt Entry Name
ELOA1_HUMAN

Uniprot Description

TCEB3: SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex). Heterotrimer of an A (A1, A2 or A3), B and C subunit. The C subunit mediates the binding of the elongin BC complex to subunit A.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 1p36.1

Cellular Component: nucleoplasm; extracellular space; cytoplasm; integral to membrane; nucleus

Molecular Function: DNA binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter; viral reproduction; positive regulation of viral transcription; RNA elongation from RNA polymerase II promoter; gene expression

Similar Products

Product Notes

The TCEB3 tceb3 (Catalog #AAA6134141) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TCEB3 (Transcription Elongation Factor B Polypeptide 3, Elongin 110kD Subunit, Elongin-A, RNA Polymerase II Transcription Factor SIII Subunit A1, SIII p110, FLJ38760, FLJ42849) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TCEB3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TCEB3 tceb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TCEB3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.