Mouse TCEB2 Monoclonal Antibody | anti-TCEB2 antibody

TCEB2 (Transcription Elongation Factor B (SIII), Polypeptide 2 (18kD, elongin B), ELOB, SIII) (Biotin)

Cat. Num. AAA6173506

• Gene Names: ELOB; SIII; TCEB2
• Applications: Western Blot
• Purity: Purified
• Synonyms: TCEB2; Monoclonal Antibody; TCEB2 (Transcription Elongation Factor B (SIII); Polypeptide 2 (18kD; elongin B); ELOB; SIII) (Biotin); Transcription Elongation Factor B (SIII); SIII; anti-TCEB2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2B4
• Specificity: Recognizes TCEB2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 118

• Applicable Applications for anti-TCEB2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TCEB2 (AAH13306, 1aa-118aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TCEB2 is 3 ng/ml as a capture antibody.)

Related Product Information for anti-TCEB2 antibody

This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq]

Product Categories/Family for anti-TCEB2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 15342072
• NCBI GeneID: 6923
• NCBI Official Full Name: Transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)
• NCBI Official Synonym Full Names: elongin B
• NCBI Official Symbol: ELOB
• NCBI Official Synonym Symbols: SIII; TCEB2
• NCBI Protein Information: elongin-B
• Protein Family: Transcription elongation factor B polypeptide

NCBI Description

This gene encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. Pseudogenes have been identified on chromosomes 11 and 13. [provided by RefSeq, Aug 2008]