Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TBX3 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse TBX3 Monoclonal Antibody | anti-TBX3 antibody

TBX3 (T-Box 3, TBX3-ISO, UMS, XHL) (FITC)

Gene Names
TBX3; UMS; XHL; TBX3-ISO
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
TBX3; Monoclonal Antibody; TBX3 (T-Box 3; TBX3-ISO; UMS; XHL) (FITC); T-Box 3; XHL; anti-TBX3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
7B3
Specificity
Recognizes TBX3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
723
Applicable Applications for anti-TBX3 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TBX3 (NP_005987, 311aa-410aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TBX3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TBX3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TBX3 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to TBX3 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-TBX3 antibody
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined. [provided by RefSeq]
Product Categories/Family for anti-TBX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
T-box transcription factor TBX3 isoform 1
NCBI Official Synonym Full Names
T-box transcription factor 3
NCBI Official Symbol
TBX3
NCBI Official Synonym Symbols
UMS; XHL; TBX3-ISO
NCBI Protein Information
T-box transcription factor TBX3
UniProt Protein Name
T-box transcription factor TBX3
UniProt Gene Name
TBX3
UniProt Synonym Gene Names
T-box protein 3
UniProt Entry Name
TBX3_HUMAN

NCBI Description

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

TBX3: Transcriptional repressor involved in developmental processes. Probably plays a role in limb pattern formation. Defects in TBX3 are the cause of ulnar-mammary syndrome (UMS). UMS is characterized by ulnar ray defects, obesity, hypogenitalism, delayed puberty, hypoplasia of nipples and apocrine glands. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 12q24.21

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding

Biological Process: embryonic forelimb morphogenesis; positive regulation of transcription, DNA-dependent; limbic system development; negative regulation of epithelial cell differentiation; palate development; negative regulation of transcription from RNA polymerase II promoter; female genitalia development; forelimb morphogenesis; mammary gland development; determination of anterior/posterior axis, embryo; positive regulation of cell proliferation; male genitalia development; heart looping; skeletal development; luteinizing hormone secretion; blood vessel development; specification of organ position; transcription, DNA-dependent; in utero embryonic development; stem cell maintenance; positive regulation of cell cycle; cell aging; regulation of transcription from RNA polymerase II promoter; organ morphogenesis; mesoderm morphogenesis; follicle-stimulating hormone secretion; embryonic digit morphogenesis; negative regulation of transcription, DNA-dependent; negative regulation of myoblast differentiation; negative regulation of apoptosis

Disease: Ulnar-mammary Syndrome

Research Articles on TBX3

Similar Products

Product Notes

The TBX3 tbx3 (Catalog #AAA6176558) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TBX3 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TBX3 tbx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TBX3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.