Mouse TBX3 Monoclonal Antibody | anti-TBX3 antibody

TBX3 (T-Box 3, TBX3-ISO, UMS, XHL) (FITC)

Cat. Num. AAA6176559

• Gene Names: TBX3; UMS; XHL; TBX3-ISO
• Applications: Western Blot
• Purity: Purified
• Synonyms: TBX3; Monoclonal Antibody; TBX3 (T-Box 3; TBX3-ISO; UMS; XHL) (FITC); T-Box 3; XHL; anti-TBX3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6C7
• Specificity: Recognizes TBX3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 723

• Applicable Applications for anti-TBX3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: TBX3 (NP_005987, 311aa-410aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TBX3 monoclonal antibody (M09), clone 6C7 Western Blot analysis of TBX3 expression in Hela S3 NE (Cat # L013V3).)

Testing Data

(Detection limit for recombinant GST tagged TBX3 is approximately 1ng/ml as a capture antibody.)

Related Product Information for anti-TBX3 antibody

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined. [provided by RefSeq]

Product Categories/Family for anti-TBX3 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 47419905
• NCBI GeneID: 6926
• NCBI Accession #: NP_005987
• NCBI GenBank Nucleotide #: NP_005987.3
• UniProt Accession #: O15119
• NCBI Official Full Name: T-box transcription factor TBX3 isoform 1
• NCBI Official Synonym Full Names: T-box transcription factor 3
• NCBI Official Symbol: TBX3
• NCBI Official Synonym Symbols: UMS; XHL; TBX3-ISO
• NCBI Protein Information: T-box transcription factor TBX3
• UniProt Protein Name: T-box transcription factor TBX3
• Protein Family: T-box transcription factor
• UniProt Gene Name: TBX3
• UniProt Synonym Gene Names: T-box protein 3
• UniProt Entry Name: TBX3_HUMAN

NCBI Description

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

TBX3: Transcriptional repressor involved in developmental processes. Probably plays a role in limb pattern formation. Defects in TBX3 are the cause of ulnar-mammary syndrome (UMS). UMS is characterized by ulnar ray defects, obesity, hypogenitalism, delayed puberty, hypoplasia of nipples and apocrine glands. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 12q24.21

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding

Biological Process: embryonic forelimb morphogenesis; positive regulation of transcription, DNA-dependent; limbic system development; negative regulation of epithelial cell differentiation; palate development; negative regulation of transcription from RNA polymerase II promoter; female genitalia development; forelimb morphogenesis; mammary gland development; determination of anterior/posterior axis, embryo; positive regulation of cell proliferation; male genitalia development; heart looping; skeletal development; luteinizing hormone secretion; blood vessel development; specification of organ position; transcription, DNA-dependent; in utero embryonic development; stem cell maintenance; positive regulation of cell cycle; cell aging; regulation of transcription from RNA polymerase II promoter; organ morphogenesis; mesoderm morphogenesis; follicle-stimulating hormone secretion; embryonic digit morphogenesis; negative regulation of transcription, DNA-dependent; negative regulation of myoblast differentiation; negative regulation of apoptosis

Disease: Ulnar-mammary Syndrome