Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human TBL1 Monoclonal Antibody | anti-TBL1 antibody

TBL1 (Transducin-beta-like Protein 1 X-linked, Transducin beta-like Protein 1X, TBL1X, EBI, F-box-like/WD Repeat-containing Protein TBL1X, SMAP55) (MaxLight 550)

Gene Names
TBL1X; EBI; TBL1; CHNG8; SMAP55
Reactivity
Human
Applications
Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TBL1; Monoclonal Antibody; TBL1 (Transducin-beta-like Protein 1 X-linked; Transducin beta-like Protein 1X; TBL1X; EBI; F-box-like/WD Repeat-containing Protein TBL1X; SMAP55) (MaxLight 550); anti-TBL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B6
Specificity
Recognizes human TBL1X.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Sequence Length
577
Applicable Applications for anti-TBL1 antibody
FLISA, Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 1.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa478-578 from human TBL1X (NP_005638) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LASASFDSTVRLWDIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-TBL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
F-box-like/WD repeat-containing protein TBL1X isoform a
NCBI Official Synonym Full Names
transducin beta like 1 X-linked
NCBI Official Symbol
TBL1X
NCBI Official Synonym Symbols
EBI; TBL1; CHNG8; SMAP55
NCBI Protein Information
F-box-like/WD repeat-containing protein TBL1X
UniProt Protein Name
F-box-like/WD repeat-containing protein TBL1X
UniProt Gene Name
TBL1X
UniProt Synonym Gene Names
TBL1
UniProt Entry Name
TBL1X_HUMAN

NCBI Description

The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This encoded protein is found as a subunit in corepressor SMRT (silencing mediator for retinoid and thyroid receptors) complex along with histone deacetylase 3 protein. This gene is located adjacent to the ocular albinism gene and it is thought to be involved in the pathogenesis of the ocular albinism with late-onset sensorineural deafness phenotype. Four transcript variants encoding two different isoforms have been found for this gene. This gene is highly similar to the Y chromosome TBL1Y gene. [provided by RefSeq, Nov 2008]

Uniprot Description

TBL1X: F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of corepressor complexes that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of transcription repressor complexes, thereby allowing cofactor exchange. Belongs to the WD repeat EBI family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: Xp22.3

Cellular Component: nucleoplasm; transcriptional repressor complex; spindle microtubule; histone deacetylase complex; nucleus

Molecular Function: protein C-terminus binding; protein domain specific binding; protein binding; histone binding; beta-catenin binding; transcription factor binding; transcription corepressor activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; Notch signaling pathway; establishment and/or maintenance of chromatin architecture; sensory perception of sound; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; histone deacetylation; positive regulation of transcription from RNA polymerase II promoter; Wnt receptor signaling pathway through beta-catenin; cellular lipid metabolic process; negative regulation of transcription from RNA polymerase II promoter; proteolysis

Research Articles on TBL1

Similar Products

Product Notes

The TBL1 tbl1x (Catalog #AAA6214344) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TBL1 (Transducin-beta-like Protein 1 X-linked, Transducin beta-like Protein 1X, TBL1X, EBI, F-box-like/WD Repeat-containing Protein TBL1X, SMAP55) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TBL1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin. IHC-P: 1.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TBL1 tbl1x for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TBL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.