Mouse anti-Human TBL1 Monoclonal Antibody | anti-TBL1 antibody

TBL1 (Transducin-beta-like Protein 1 X-linked, Transducin beta-like Protein 1X, TBL1X, EBI, F-box-like/WD Repeat-containing Protein TBL1X, SMAP55) (PE)

Cat. Num. AAA6160645

• Gene Names: TBL1X; EBI; TBL1; CHNG8; SMAP55
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TBL1; Monoclonal Antibody; TBL1 (Transducin-beta-like Protein 1 X-linked; Transducin beta-like Protein 1X; TBL1X; EBI; F-box-like/WD Repeat-containing Protein TBL1X; SMAP55) (PE); anti-TBL1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2B6
• Specificity: Recognizes human TBL1X.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 577

• Applicable Applications for anti-TBL1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin
• Application Notes: IHC-P: 1.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa478-578 from human TBL1X (NP_005638) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LASASFDSTVRLWDIERGVCTHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to TBL1X on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1.5ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TBL1X is ~0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CACYBP and TBL1X HeLa cells were stained with CACYBP rabbit purified polyclonal 1:1200 and TBL1X mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Product Categories/Family for anti-TBL1 antibody

Antibodies; Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 5032159
• NCBI GeneID: 6907
• NCBI Accession #: NP_005638
• NCBI GenBank Nucleotide #: NM_005647
• UniProt Accession #: O60907
• NCBI Official Full Name: F-box-like/WD repeat-containing protein TBL1X isoform a
• NCBI Official Synonym Full Names: transducin beta like 1 X-linked
• NCBI Official Symbol: TBL1X
• NCBI Official Synonym Symbols: EBI; TBL1; CHNG8; SMAP55
• NCBI Protein Information: F-box-like/WD repeat-containing protein TBL1X
• UniProt Protein Name: F-box-like/WD repeat-containing protein TBL1X
• Protein Family: Protein trichome birefringence
• UniProt Gene Name: TBL1X
• UniProt Synonym Gene Names: TBL1
• UniProt Entry Name: TBL1X_HUMAN

NCBI Description

The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This encoded protein is found as a subunit in corepressor SMRT (silencing mediator for retinoid and thyroid receptors) complex along with histone deacetylase 3 protein. This gene is located adjacent to the ocular albinism gene and it is thought to be involved in the pathogenesis of the ocular albinism with late-onset sensorineural deafness phenotype. Four transcript variants encoding two different isoforms have been found for this gene. This gene is highly similar to the Y chromosome TBL1Y gene. [provided by RefSeq, Nov 2008]

Uniprot Description

TBL1X: F-box-like protein involved in the recruitment of the ubiquitin/19S proteasome complex to nuclear receptor-regulated transcription units. Plays an essential role in transcription activation mediated by nuclear receptors. Probably acts as integral component of corepressor complexes that mediates the recruitment of the 19S proteasome complex, leading to the subsequent proteasomal degradation of transcription repressor complexes, thereby allowing cofactor exchange. Belongs to the WD repeat EBI family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: Xp22.3

Cellular Component: nucleoplasm; transcriptional repressor complex; spindle microtubule; histone deacetylase complex; nucleus

Molecular Function: protein C-terminus binding; protein domain specific binding; protein binding; histone binding; beta-catenin binding; transcription factor binding; transcription corepressor activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; Notch signaling pathway; establishment and/or maintenance of chromatin architecture; sensory perception of sound; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; histone deacetylation; positive regulation of transcription from RNA polymerase II promoter; Wnt receptor signaling pathway through beta-catenin; cellular lipid metabolic process; negative regulation of transcription from RNA polymerase II promoter; proteolysis