Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human TBCK Monoclonal Antibody | anti-TBCK antibody

TBCK (TBC Domain-containing Protein Kinase-like Protein, TBCKL, HSPC302, MGC16169) (AP)

Gene Names
TBCK; TBCKL; HSPC302
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TBCK; Monoclonal Antibody; TBCK (TBC Domain-containing Protein Kinase-like Protein; TBCKL; HSPC302; MGC16169) (AP); anti-TBCK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7A7
Specificity
Recognizes human MGC16169.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TBCK antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa601-701 from human MGC16169 (NP_149106) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QQLRDRLLANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPPKPSSDSSGGRSSAPYFSAECPDPPKTDLSRESIPLNDLKSEVSPRI
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(MGC16169 monoclonal antibody, Western Blot analysis of MGC16169 expression in HeLa.)

Western Blot (WB) (MGC16169 monoclonal antibody, Western Blot analysis of MGC16169 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of MGC16169 expression in transfected 293T cell line by MGC16169 monoclonal antibody. Lane 1: MGC16169 transfected lysate (93.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MGC16169 expression in transfected 293T cell line by MGC16169 monoclonal antibody. Lane 1: MGC16169 transfected lysate (93.7kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to MGC16169 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to MGC16169 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged MGC16169 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MGC16169 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-TBCK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93,725 Da
NCBI Official Full Name
TBC domain-containing protein kinase-like protein isoform c
NCBI Official Synonym Full Names
TBC1 domain containing kinase
NCBI Official Symbol
TBCK
NCBI Official Synonym Symbols
TBCKL; HSPC302
NCBI Protein Information
TBC domain-containing protein kinase-like protein; TBCK
UniProt Protein Name
TBC domain-containing protein kinase-like protein
UniProt Gene Name
TBCK
UniProt Entry Name
TBCK_HUMAN

Similar Products

Product Notes

The TBCK tbck (Catalog #AAA6132304) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TBCK (TBC Domain-containing Protein Kinase-like Protein, TBCKL, HSPC302, MGC16169) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TBCK can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TBCK tbck for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TBCK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.