<
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Mouse anti-Human TBC1D8 Monoclonal Antibody | anti-Tbc1d8 antibody
TBC1D8 (TBC1 Domain Family Member 8, AD 3, Vascular Rab-GAP/TBC-containing Protein, VRP)
Gene Names
Tbc1d8; AD3; VRP; HBLP1
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
TBC1D8; Monoclonal Antibody; TBC1D8 (TBC1 Domain Family Member 8; AD 3; Vascular Rab-GAP/TBC-containing Protein; VRP); Anti -TBC1D8 (TBC1 Domain Family Member 8; anti-Tbc1d8 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A12
Specificity
Recognizes human TBC1D8.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEQLADVTLRRLLDNEVFDLDPDLQEPSQITKRDLEARAQNEFFRAFFRLPRKEKLHAVVDCSLWTPFSRCHTAGRMFASDSYICFASREDGCCKIILPLREVVSIEKME*
Applicable Applications for anti-Tbc1d8 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa1-111 from TBC1D8 (NP_008994) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (38.21kD).)
Western Blot (WB)
(TBC1D8 monoclonal antibody. Western Blot analysis of TBC1D8 expression in K-562)
Western Blot (WB)
(TBC1D8 monoclonal antibody. Western Blot analysis of TBC1D8 expression in K-562)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TBC1D8 on HeLa cell. [antibody concentration 10ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to TBC1D8 on HeLa cell. [antibody concentration 10ug/ml])
Testing Data
(Detection limit for recombinant GST tagged TBC1D8 is ~3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TBC1D8 is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-Tbc1d8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
130,057 Da
NCBI Official Full Name
Tbc1d8 protein
NCBI Official Synonym Full Names
TBC1 domain family, member 8
NCBI Official Symbol
Tbc1d8
NCBI Official Synonym Symbols
AD3; VRP; HBLP1
NCBI Protein Information
TBC1 domain family member 8; GRAM domain; BUB2-like protein 1; vascular Rab-GAP/TBC-containing protein
UniProt Protein Name
TBC1 domain family member 8
Protein Family
UniProt Gene Name
Tbc1d8
UniProt Synonym Gene Names
Hblp1; Vrp
UniProt Entry Name
TBCD8_MOUSE
Uniprot Description
TBC1D8: a putative GTPase activating protein for Rab family protein(s).
Protein type: GAPs, Rab; GAPs
Molecular Function: GTPase activator activity
Biological Process: regulation of GTPase activity
Similar Products
Product Notes
The Tbc1d8 tbc1d8 (Catalog #AAA644280) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TBC1D8 (TBC1 Domain Family Member 8, AD 3, Vascular Rab-GAP/TBC-containing Protein, VRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TBC1D8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the Tbc1d8 tbc1d8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEQLADVTLR RLLDNEVFDL DPDLQEPSQI TKRDLEARAQ NEFFRAFFRL PRKEKLHAVV DCSLWTPFSR CHTAGRMFAS DSYICFASRE DGCCKIILPL REVVSIEKME *. It is sometimes possible for the material contained within the vial of "TBC1D8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
