Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human TAX1BP1 Monoclonal Antibody | anti-TAX1BP1 antibody

TAX1BP1 (Tax1-binding Protein 1, TRAF6-binding Protein, T6BP, PRO0105) (MaxLight 490)

Gene Names
TAX1BP1; T6BP; TXBP151; CALCOCO3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TAX1BP1; Monoclonal Antibody; TAX1BP1 (Tax1-binding Protein 1; TRAF6-binding Protein; T6BP; PRO0105) (MaxLight 490); anti-TAX1BP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C3
Specificity
Recognizes human TAX1BP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
789
Applicable Applications for anti-TAX1BP1 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa690-790 from TAX1BP1 (NP_006015) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TAX1BP1 antibody
Inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degraded by caspase-3-like family proteins upon TNF-induced apoptosis. May also play a role in the pro-inflammatory cytokine IL-1 signaling cascade.
Product Categories/Family for anti-TAX1BP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
tax1-binding protein 1 isoform 1
NCBI Official Synonym Full Names
Tax1 binding protein 1
NCBI Official Symbol
TAX1BP1
NCBI Official Synonym Symbols
T6BP; TXBP151; CALCOCO3
NCBI Protein Information
tax1-binding protein 1
UniProt Protein Name
Tax1-binding protein 1
Protein Family
UniProt Gene Name
TAX1BP1
UniProt Synonym Gene Names
T6BP
UniProt Entry Name
TAXB1_HUMAN

NCBI Description

This gene encodes a HTLV-1 tax1 binding protein. The encoded protein interacts with TNFAIP3, and inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degradation of this protein by caspase-3-like family proteins is associated with apoptosis induced by TNF. This protein may also have a role in the inhibition of inflammatory signaling pathways. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2011]

Uniprot Description

TAX1BP1: Inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degraded by caspase-3-like family proteins upon TNF-induced apoptosis. May also play a role in the pro-inflammatory cytokine IL-1 signaling cascade. Homooligomer. Interacts with TRAF6 in a IL-1-dependent manner. Interacts with TNFAIP3. Interacts with STARD13. Interacts with the HTLV-1 protein Tax-1. Expressed in all tissues tested. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis

Chromosomal Location of Human Ortholog: 7p15

Cellular Component: cytosol

Molecular Function: protein binding; metal ion binding; kinase binding

Biological Process: inhibition of NF-kappaB transcription factor; apoptosis; innate immune response; negative regulation of interferon type I production; negative regulation of apoptosis

Research Articles on TAX1BP1

Similar Products

Product Notes

The TAX1BP1 tax1bp1 (Catalog #AAA6203664) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TAX1BP1 (Tax1-binding Protein 1, TRAF6-binding Protein, T6BP, PRO0105) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAX1BP1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAX1BP1 tax1bp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAX1BP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.