Mouse anti-Human TAPBPL Monoclonal Antibody | anti-TAPBPL antibody

TAPBPL (TAP-binding Protein-like, Tapasin-related Protein, TAPASIN-R, TAP-binding Protein-related Protein, TAPBPR, TAPBP-R, Tapasin-like)

Cat. Num. AAA644394

• Gene Names: TAPBPL; TAPBPR; TAPBP-R
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: TAPBPL; Monoclonal Antibody; TAPBPL (TAP-binding Protein-like; Tapasin-related Protein; TAPASIN-R; TAP-binding Protein-related Protein; TAPBPR; TAPBP-R; Tapasin-like); Anti -TAPBPL (TAP-binding Protein-like; anti-TAPBPL antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6E3
• Specificity: Recognizes human TAPBPL.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: PHPAEGQWRAVDVVLDCFLVKDGAHRGALASSEDRARASLVLKQVPVLDDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVT

• Applicable Applications for anti-TAPBPL antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa23-122 from human TAPBPL (NP_060479) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(TAPBPL monoclonal antibody, Western Blot analysis of TAPBPL expression in A-431.)

Western Blot (WB)

(Western Blot analysis of TAPBPL expression in transfected 293T cell line by TAPBPL monoclonal antibody.|Lane 1: TAPBPL transfected lysate (50.2kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged TAPBPL is ~0.03ng/ml as a capture antibody.)

Product Categories/Family for anti-TAPBPL antibody

Antibodies; Abs to Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 157739930
• NCBI GeneID: 55080
• NCBI Accession #: NP_060479.3
• NCBI GenBank Nucleotide #: NM_018009.4
• UniProt Accession #: Q9BX59; Q9NWB8
• Molecular Weight: 50,183 Da
• NCBI Official Full Name: tapasin-related protein
• NCBI Official Synonym Full Names: TAP binding protein-like
• NCBI Official Symbol: TAPBPL
• NCBI Official Synonym Symbols: TAPBPR; TAPBP-R
• NCBI Protein Information: tapasin-related protein; TAPASIN-R; tapasin-like; TAP-binding protein-like; TAP binding protein related; TAP-binding protein-related protein
• UniProt Protein Name: Tapasin-related protein
• Protein Family: Tapasin-related protein
• UniProt Gene Name: TAPBPL
• UniProt Synonym Gene Names: TAPASIN-R; TAPBP-R
• UniProt Entry Name: TPSNR_HUMAN

NCBI Description

Tapasin, or TAPBP (MIM 601962), is a member of the variable-constant Ig superfamily that links major histocompatibility complex (MHC) class I molecules to the transporter associated with antigen processing (TAP; see MIM 170260) in the endoplasmic reticulum (ER). The TAPBP gene is located near the MHC complex on chromosome 6p21.3. TAPBPL is a member of the Ig superfamily that is localized on chromosome 12p13.3, a region somewhat paralogous to the MHC.[supplied by OMIM, Mar 2008]

Uniprot Description

TAPBPL: Component of the antigen processing and presentation pathway, which binds to MHC class I coupled with beta2- microglobulin/B2M. Association between TAPBPR and MHC class I occurs in the absence of a functional peptide-loading complex (PLC). Expression seems to slow down and down-regulate MHC class I surface expression. {ECO:0000269|PubMed:23401559}. Induced by interferon gamma. {ECO:0000269|PubMed:23401559}. 7 isoforms of the human protein are produced by alternative splicing

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: Golgi membrane; endoplasmic reticulum membrane; integral to membrane; plasma membrane

Molecular Function: protein complex binding

Biological Process: negative regulation of antigen processing and presentation of peptide antigen via MHC class I; immune system process