Testing Data
(Detection limit for recombinant GST tagged TAL2 is ~0.03ng/ml as a capture antibody.)
Mouse anti-Human TAL2 Monoclonal Antibody | anti-TAL2 antibody
TAL2 (T-cell Acute Lymphocytic Leukemia Protein 2, TAL-2, Class A Basic Helix-loop-helix Protein 19, bHLHa19, BHLHA19) (Biotin)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TAL2; Monoclonal Antibody; TAL2 (T-cell Acute Lymphocytic Leukemia Protein 2; TAL-2; Class A Basic Helix-loop-helix Protein 19; bHLHa19; BHLHA19) (Biotin); anti-TAL2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G6
Specificity
Recognizes human TAL2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-TAL2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa29-109 from human TAL2 (NP_005412) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged TAL2 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TAL2 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-TAL2 antibody
A chromosomal aberration involving TAL2 may be a cause of some T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(7;9)(q34;q32) with TCRB.
Product Categories/Family for anti-TAL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
T-cell acute lymphocytic leukemia protein 2
NCBI Official Synonym Full Names
TAL bHLH transcription factor 2
NCBI Official Symbol
TAL2
NCBI Protein Information
T-cell acute lymphocytic leukemia protein 2
UniProt Protein Name
T-cell acute lymphocytic leukemia protein 2
Protein Family
UniProt Gene Name
TAL2
UniProt Synonym Gene Names
BHLHA19; TAL-2; bHLHa19
UniProt Entry Name
TAL2_HUMAN
NCBI Description
This intronless gene encodes a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia. [provided by RefSeq, Mar 2009]
Research Articles on TAL2
Similar Products
Product Notes
The TAL2 tal2 (Catalog #AAA6144721) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TAL2 (T-cell Acute Lymphocytic Leukemia Protein 2, TAL-2, Class A Basic Helix-loop-helix Protein 19, bHLHa19, BHLHA19) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAL2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAL2 tal2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
