Mouse anti-Human TAF7 Monoclonal Antibody | anti-TAF7 antibody

TAF7 (TAF2F, TAFII55, Transcription Initiation Factor TFIID Subunit 7, RNA Polymerase II TBP-associated Factor Subunit F, Transcription Initiation Factor TFIID 55kD Subunit, TAF(II)55, TAFII-55) (AP)

Cat. Num. AAA6134110

• Gene Names: TAF7; TAF2F; TAFII55
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TAF7; Monoclonal Antibody; TAF7 (TAF2F; TAFII55; Transcription Initiation Factor TFIID Subunit 7; RNA Polymerase II TBP-associated Factor Subunit F; Transcription Initiation Factor TFIID 55kD Subunit; TAF(II)55; TAFII-55) (AP); anti-TAF7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2C5
• Specificity: Recognizes human TAF7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-TAF7 antibody: ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa130-224 from human TAF7 (AAH32737) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFN
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TAF7 monoclonal antibody, Western Blot analysis of TAF7 expression in MCF-7.)

Western Blot (WB)

(Western Blot analysis of TAF7 expression in transfected 293T cell line by TAF7 monoclonal antibody. Lane 1: TAF7 transfected lysate (40.3kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to TAF7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to TAF7 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged TAF7 is ~0.3ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of TAF7 over-expressed 293 cell line, cotransfected with TAF7 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TAF7 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Product Categories/Family for anti-TAF7 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 22749797
• NCBI GeneID: 6879
• Molecular Weight: 40,259 Da
• NCBI Official Full Name: Homo sapiens TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa, mRNA
• NCBI Official Synonym Full Names: TATA-box binding protein associated factor 7
• NCBI Official Symbol: TAF7
• NCBI Official Synonym Symbols: TAF2F; TAFII55
• NCBI Protein Information: transcription initiation factor TFIID subunit 7
• Protein Family: Transcription initiation factor

NCBI Description

The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq, Jul 2008]