Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human TAF1A Monoclonal Antibody | anti-TAF1A antibody

TAF1A (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit A, RNA Polymerase I-specific TBP-associated Factor 48kD, TATA Box-binding Protein-associated Factor 1A, Transcription Factor SL1, Transcription Initiation Factor SL1/TIF-IB Subunit

Gene Names
TAF1A; SL1; RAFI48; TAFI48; MGC:17061
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TAF1A; Monoclonal Antibody; TAF1A (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit A; RNA Polymerase I-specific TBP-associated Factor 48kD; TATA Box-binding Protein-associated Factor 1A; Transcription Factor SL1; Transcription Initiation Factor SL1/TIF-IB Subunit; anti-TAF1A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F8
Specificity
Recognizes human TAF1A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-TAF1A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from TAF1A (NP_005672) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSDFSEELKGPVTDDEEVETSVLSGAGMHFPWLQTYVETVAIGGKRRKDFAQTTSACLSFIQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIW
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged TAF1A is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TAF1A is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-TAF1A antibody
Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the smallest SL1-specific TAF. Two transcripts encoding different isoforms have been identified.
Product Categories/Family for anti-TAF1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
TATA box-binding protein-associated factor RNA polymerase I subunit A isoform 1
NCBI Official Synonym Full Names
TATA-box binding protein associated factor, RNA polymerase I subunit A
NCBI Official Symbol
TAF1A
NCBI Official Synonym Symbols
SL1; RAFI48; TAFI48; MGC:17061
NCBI Protein Information
TATA box-binding protein-associated factor RNA polymerase I subunit A
UniProt Protein Name
TATA box-binding protein-associated factor RNA polymerase I subunit A
UniProt Gene Name
TAF1A
UniProt Synonym Gene Names
TAFI48
UniProt Entry Name
TAF1A_HUMAN

NCBI Description

This gene encodes a subunit of the RNA polymerase I complex, Selectivity Factor I (SLI). The encoded protein is a TATA box-binding protein-associated factor that plays a role in the assembly of the RNA polymerase I preinitiation complex. Alternate splicing results in multiple transcript variants encoding multiple isoforms.[provided by RefSeq, Jan 2011]

Uniprot Description

TAF1A: Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 1q42

Cellular Component: microtubule cytoskeleton; nucleoplasm; intracellular membrane-bound organelle; RNA polymerase I transcription factor complex; nucleus

Molecular Function: protein binding; DNA binding

Biological Process: transcription from RNA polymerase II promoter; chromatin silencing at rDNA; negative regulation of gene expression, epigenetic; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; gene expression; termination of RNA polymerase I transcription; transcription initiation from RNA polymerase I promoter; regulation of gene expression, epigenetic

Research Articles on TAF1A

Similar Products

Product Notes

The TAF1A taf1a (Catalog #AAA6150015) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TAF1A (TATA Box-binding Protein-associated Factor RNA Polymerase I Subunit A, RNA Polymerase I-specific TBP-associated Factor 48kD, TATA Box-binding Protein-associated Factor 1A, Transcription Factor SL1, Transcription Initiation Factor SL1/TIF-IB Subunit reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAF1A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAF1A taf1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAF1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.