Mouse anti-Human TAF13 Monoclonal Antibody | anti-TAF13 antibody

TAF13 (Transcription Initiation Factor TFIID Subunit 13, Transcription Initiation Factor TFIID 18kD Subunit, TAF(II)18, TAFII-18, TAFII18, TAF2K, TAFII18, MGC22425) (HRP)

Cat. Num. AAA6155317

• Gene Names: TAF13; MRT60; TAF2K; TAFII18; TAFII-18; TAF(II)18
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TAF13; Monoclonal Antibody; TAF13 (Transcription Initiation Factor TFIID Subunit 13; Transcription Initiation Factor TFIID 18kD Subunit; TAF(II)18; TAFII-18; TAFII18; TAF2K; MGC22425) (HRP); anti-TAF13 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2B3
• Specificity: Recognizes human TAF13.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-TAF13 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa27-125 from human TAF13 (NP_005636) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TAF13 is 1ng/ml as a capture antibody.)

Product Categories/Family for anti-TAF13 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 5032155
• NCBI GeneID: 6884
• NCBI Accession #: NP_005636
• NCBI GenBank Nucleotide #: NM_005645
• UniProt Accession #: Q15543
• Molecular Weight: 14kDa
• NCBI Official Full Name: transcription initiation factor TFIID subunit 13
• NCBI Official Synonym Full Names: TATA-box binding protein associated factor 13
• NCBI Official Symbol: TAF13
• NCBI Official Synonym Symbols: MRT60; TAF2K; TAFII18; TAFII-18; TAF(II)18
• NCBI Protein Information: transcription initiation factor TFIID subunit 13
• UniProt Protein Name: Transcription initiation factor TFIID subunit 13
• Protein Family: Transcription initiation factor
• UniProt Gene Name: TAF13
• UniProt Synonym Gene Names: TAF2K; TAFII18; TAF(II)18; TAFII-18; TAFII18
• UniProt Entry Name: TAF13_HUMAN

NCBI Description

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6. [provided by RefSeq, Jul 2008]

Uniprot Description

TAF13: a TBP-associated factor (TAF). A component of TFIID complexes composed of the TATA binding protein (TBP), TAF10 and TAF11. TAF13 and TAF10 contain non-canonical histone folds, forming a histone-like pair in TFIID complexes.

Protein type: Translation

Chromosomal Location of Human Ortholog: 1p13.3

Cellular Component: nucleoplasm; transcription factor TFIID complex; nucleolus; nucleus

Molecular Function: protein C-terminus binding; protein binding; DNA binding; protein heterodimerization activity; transcription cofactor activity; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; viral reproduction; transcription initiation; RNA elongation from RNA polymerase II promoter; gene expression