Mouse anti-Human TAF12 Monoclonal Antibody | anti-TAF12 antibody

TAF12 (Transcription Initiation Factor TFIID Subunit 12, Transcription Initiation Factor TFIID 20/15kD Subunits, TAFII-20/TAFII-15, TAFII20/TAFII15, TAF15, TAF2J, TAFII20) APC

Cat. Num. AAA6139407

• Gene Names: TAF12; TAF2J; TAFII20
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: TAF12; Monoclonal Antibody; TAF12 (Transcription Initiation Factor TFIID Subunit 12; Transcription Initiation Factor TFIID 20/15kD Subunits; TAFII-20/TAFII-15; TAFII20/TAFII15; TAF15; TAF2J; TAFII20) APC; anti-TAF12 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1E10
• Specificity: Recognizes human TAF12.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-TAF12 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-162 from human TAF12 (AAH11986) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TAF12 monoclonal antibody. Western Blot analysis of TAF12 expression in Hela NE.)

Testing Data

(Detection limit for recombinant GST tagged TAF12 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-TAF12 antibody

TAFs are components of the transcription factor IID (TFIID) complex, PCAF histone acetylase complex and TBP-free TAFII complex (TFTC). TAFs components-TIIFD are essential for mediating regulation of RNA polymerase transcription.

Product Categories/Family for anti-TAF12 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15080484
• NCBI GeneID: 6883
• Molecular Weight: 14,825 Da
• NCBI Official Full Name: Homo sapiens TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa, mRNA
• NCBI Official Synonym Full Names: TATA-box binding protein associated factor 12
• NCBI Official Symbol: TAF12
• NCBI Official Synonym Symbols: TAF2J; TAFII20
• NCBI Protein Information: transcription initiation factor TFIID subunit 12
• Protein Family: Transcription initiation factor

NCBI Description

Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2008]