Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged TAF1 is ~0.1ng/ml as a capture antibody.)

Mouse anti-Human TAF1 Monoclonal Antibody | anti-TAF1 antibody

TAF1 (Transcription Initiation Factor TFIID Subunit 1, Cell Cycle Gene 1 Protein, TBP-associated Factor 250kD, p250, Transcription Initiation Factor TFIID 250kD Subunit, TAF(II)250, TAFII-250, TAFII250, BA2R, CCG1, CCGS, TAF2A) (PE)

Gene Names
TAF1; OF; XDP; BA2R; CCG1; CCGS; DYT3; KAT4; P250; NSCL2; TAF2A; MRXS33; N-TAF1; TAFII250; DYT3/TAF1; TAFII-250; TAF(II)250
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TAF1; Monoclonal Antibody; TAF1 (Transcription Initiation Factor TFIID Subunit 1; Cell Cycle Gene 1 Protein; TBP-associated Factor 250kD; p250; Transcription Initiation Factor TFIID 250kD Subunit; TAF(II)250; TAFII-250; TAFII250; BA2R; CCG1; CCGS; TAF2A) (PE); anti-TAF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E11
Specificity
Recognizes human TAF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-TAF1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1784-1894 from human TAF1 (NP_004597) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged TAF1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged TAF1 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-TAF1 antibody
BTAF1 regulates transcription in association with TATA binding protein (TBP). It removes TBP from the TATA box in an ATP-dependent manner.
Product Categories/Family for anti-TAF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
215kDa
NCBI Official Full Name
transcription initiation factor TFIID subunit 1 isoform 1
NCBI Official Synonym Full Names
TATA-box binding protein associated factor 1
NCBI Official Symbol
TAF1
NCBI Official Synonym Symbols
OF; XDP; BA2R; CCG1; CCGS; DYT3; KAT4; P250; NSCL2; TAF2A; MRXS33; N-TAF1; TAFII250; DYT3/TAF1; TAFII-250; TAF(II)250
NCBI Protein Information
transcription initiation factor TFIID subunit 1
UniProt Protein Name
Transcription initiation factor TFIID subunit 1
Protein Family
UniProt Gene Name
TAF1
UniProt Synonym Gene Names
BA2R; CCG1; CCGS; TAF2A; p250; TAF(II)250; TAFII-250; TAFII250
UniProt Entry Name
TAF1_HUMAN

NCBI Description

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N- and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. Mutations in this gene result in Dystonia 3, torsion, X-linked, a dystonia-parkinsonism disorder. Alternative splicing of this gene results in multiple transcript variants. This gene is part of a complex transcription unit (TAF1/DYT3), wherein some transcript variants share exons with TAF1 as well as additional downstream DYT3 exons. [provided by RefSeq, Oct 2013]

Uniprot Description

TAF1: Largest component and core scaffold of the TFIID basal transcription factor complex. Contains novel N- and C-terminal Ser/Thr kinase domains which can autophosphorylate or transphosphorylate other transcription factors. Phosphorylates TP53 on 'Thr-55' which leads to MDM2-mediated degradation of TP53. Phosphorylates GTF2A1 and GTF2F1 on Ser residues. Possesses DNA- binding activity. Essential for progression of the G1 phase of the cell cycle. Defects in TAF1 are the cause of dystonia type 3 (DYT3); also called X-linked dystonia-parkinsonism (XDP). DYT3 is a X-linked dystonia-parkinsonism disorder. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. DYT3 is characterized by severe progressive torsion dystonia followed by parkinsonism. Its prevalence is high in the Philippines. DYT3 has a well-defined pathology of extensive neuronal loss and mosaic gliosis in the striatum (caudate nucleus and putamen) which appears to resemble that in Huntington disease. Belongs to the TAF1 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.3.1.48; DNA-binding; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; Kinase, protein; Protein kinase, atypical; Transcription, coactivator/corepressor; ATYPICAL group; TAF1 family

Chromosomal Location of Human Ortholog: Xq13.1

Cellular Component: nucleoplasm; transcription factor TFIID complex

Molecular Function: protein serine/threonine kinase activity; protein binding; histone acetyltransferase activity; p53 binding; sequence-specific DNA binding; TATA-binding protein binding; transcription coactivator activity; transcription factor binding; ATP binding

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; viral reproduction; protein amino acid autophosphorylation; transcription initiation; peptidyl-threonine phosphorylation; transcriptional preinitiation complex assembly; cell cycle; peptidyl-serine phosphorylation; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; RNA elongation from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase II promoter; gene expression; histone acetylation; response to DNA damage stimulus

Disease: Dystonia 3, Torsion, X-linked

Research Articles on TAF1

Similar Products

Product Notes

The TAF1 taf1 (Catalog #AAA6160617) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TAF1 (Transcription Initiation Factor TFIID Subunit 1, Cell Cycle Gene 1 Protein, TBP-associated Factor 250kD, p250, Transcription Initiation Factor TFIID 250kD Subunit, TAF(II)250, TAFII-250, TAFII250, BA2R, CCG1, CCGS, TAF2A) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TAF1 taf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TAF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.